Amyloid β-peptide (1-42) (rat)

Pricing Availability   Qty
Description: Predominant amyloid β-protein fragment
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews
Literature (1)

Biological Activity for Amyloid β-peptide (1-42) (rat)

Amyloid β-peptide (1-42) (rat) is a rat form of the predominant amyloid β-peptide found in plaques associated with Alzheimer's disease. Leads to a large shift in the bax/bcl-2 ratio in favour of pro-apoptotic bax. Neurotoxic.

Technical Data for Amyloid β-peptide (1-42) (rat)

M. Wt 4417.99
Formula C199H307N53O59S
Sequence DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 166090-74-0
PubChem ID 71581490
InChI Key HAWSUONKNKRLRH-ANECVMDESA-N
Smiles [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Amyloid β-peptide (1-42) (rat)

Solubility Soluble to 1 mg/ml in 0.1% Ammonia

Product Datasheets for Amyloid β-peptide (1-42) (rat)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Amyloid β-peptide (1-42) (rat)

References are publications that support the biological activity of the product.

Van Nostrand et al (1996) Amyloid β-protein induces the cerebrovascular cellular pathology of Alzheimer's disease and related disorders. Ann.N.Y.Acad.Sci. 777 297 PMID: 8624102

Glenner and Wong (1984) Alzheimer's disease: initial report of the purification and characterization of a novel cerebrovascular amyloid protein. Biochem.Biophys.Res.Comm. 120 885

Clementi et al (2006) Alzheimer's amyloid β-peptide (1-42) induces cell death in human neuroblastoma via bax/bcl-2 ratio increase: An intriguing role for methionine 35. Biochem.Biophys.Res.Comm. 342 206


If you know of a relevant reference for Amyloid β-peptide (1-42) (rat), please let us know.

View Related Products by Target

Keywords: Amyloid beta-peptide (1-42) (rat), Amyloid beta-peptide (1-42) (rat) supplier, Amyloid, β-protein, beta-protein, fragment, β-Amyloid, beta-Amyloid, b-amyloid, Precursor, Protein, APP, Secretase, beta, Peptides, β-peptide, beta-peptide, 1-42, (rat), amyloidbeta, amyloidb, amyloidβ, Beta, 2425, Tocris Bioscience

1 Citation for Amyloid β-peptide (1-42) (rat)

Citations are publications that use Tocris products. Selected citations for Amyloid β-peptide (1-42) (rat) include:

Yulei et al (2016) Partial Amelioration of Synaptic and Cognitive Deficits by Inhibiting Cofilin Dephosphorylation in an Animal Model of Alzheimer's Disease Journal of Alzheimer's Disease 53 1419 PMID: 27372643


Do you know of a great paper that uses Amyloid β-peptide (1-42) (rat) from Tocris? Please let us know.

Reviews for Amyloid β-peptide (1-42) (rat)

There are currently no reviews for this product. Be the first to review Amyloid β-peptide (1-42) (rat) and earn rewards!

Have you used Amyloid β-peptide (1-42) (rat)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Alzheimer's Disease Poster

Alzheimer's Disease Poster

Alzheimer's disease (AD) is a debilitating and progressive neurodegenerative disease and the most common cause of dementia, affecting approximately 30% of individuals aged over 85 years. This poster summarizes the cellular and molecular mechanisms of AD.