Amyloid β-Peptide (1-37) (human)

Discontinued Product

7031 has been discontinued.

Description: Amyloid β-protein fragment
Datasheet
Citations
Reviews
Literature (1)

Biological Activity for Amyloid β-Peptide (1-37) (human)

Amyloid β-Peptide (1-37) (human) is a human amyloid β-protein fragment cleaved from amyloid precursor protein (APP). Minor Aβ fragment identified in brains of APP23 mice and human Alzheimer's disease patients.

Technical Data for Amyloid β-Peptide (1-37) (human)

M. Wt 4074.53
Formula C182H274N50O55S
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Storage Store at -20°C
CAS Number 186359-67-1
InChI Key LKNGNRVBKQEJPA-IUMSEVKGSA-N
Smiles [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for Amyloid β-Peptide (1-37) (human)

References for Amyloid β-Peptide (1-37) (human)

References are publications that support the biological activity of the product.

Schieb et al (2011) Beta-amyloid peptide variants in brains and cerebrospinal fluid from amyloid precursor protein (APP) transgenic mice: comparison with human Alzheimer amyloid. J.Biol.Chem. 286 33747 PMID: 21795681

View Related Products by Target

Keywords: Amyloid beta-Peptide (1-37) (human), Amyloid beta-Peptide (1-37) (human) supplier, amyloid, beta, peptide, 1-37, alzheimers, disease, APP, precusor, protein, Amyloid, Beta, Peptides, 7031, Tocris Bioscience

Citations for Amyloid β-Peptide (1-37) (human)

Citations are publications that use Tocris products.

Currently there are no citations for Amyloid β-Peptide (1-37) (human).

Reviews for Amyloid β-Peptide (1-37) (human)

There are currently no reviews for this product. Be the first to review Amyloid β-Peptide (1-37) (human) and earn rewards!

Have you used Amyloid β-Peptide (1-37) (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Alzheimer's Disease Poster

Alzheimer's Disease Poster

Alzheimer's disease (AD) is a debilitating and progressive neurodegenerative disease and the most common cause of dementia, affecting approximately 30% of individuals aged over 85 years. This poster summarizes the cellular and molecular mechanisms of AD.