Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit Review7031 has been discontinued.
Amyloid β-Peptide (1-37) (human) is a human amyloid β-protein fragment cleaved from amyloid precursor protein (APP). Minor Aβ fragment identified in brains of APP23 mice and human Alzheimer's disease patients.
| M. Wt | 4074.53 |
| Formula | C182H274N50O55S |
| Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG |
| Storage | Store at -20°C |
| CAS Number | 186359-67-1 |
| InChI Key | LKNGNRVBKQEJPA-IUMSEVKGSA-N |
| Smiles | [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Schieb et al (2011) Beta-amyloid peptide variants in brains and cerebrospinal fluid from amyloid precursor protein (APP) transgenic mice: comparison with human Alzheimer amyloid. J.Biol.Chem. 286 33747 PMID: 21795681
Keywords: Amyloid beta-Peptide (1-37) (human), Amyloid beta-Peptide (1-37) (human) supplier, amyloid, beta, peptide, 1-37, alzheimers, disease, APP, precusor, protein, Amyloid, Beta, Peptides, 7031, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Amyloid β-Peptide (1-37) (human).
There are currently no reviews for this product. Be the first to review Amyloid β-Peptide (1-37) (human) and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image