Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewAmyloid β-Peptide (1-37) (human) New
Description: Amyloid β-protein fragment
Biological Activity
Human amyloid β-protein fragment cleaved from amyloid precursor protein (APP). Minor Aβ fragment identified in brains of APP23 mice and human Alzheimer's disease patients.
Technical Data
| M. Wt | 4074.53 |
| Formula | C182H274N50O55S |
| Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG |
| Storage | Store at -20°C |
| CAS Number | 186359-67-1 |
| InChI Key | LKNGNRVBKQEJPA-IUMSEVKGSA-N |
| Smiles | [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data
| Solubility | Soluble to 1 mg/ml in DMSO |
Product Datasheets
References
References are publications that support the biological activity of the product.
Schieb et al (2011) Beta-amyloid peptide variants in brains and cerebrospinal fluid from amyloid precursor protein (APP) transgenic mice: comparison with human Alzheimer amyloid. J.Biol.Chem. 286 33747 PMID: 21795681
If you know of a relevant reference for Amyloid β-Peptide (1-37) (human), please let us know.
View Related Products by Target
Keywords: Amyloid beta-Peptide (1-37) (human), Amyloid beta-Peptide (1-37) (human) supplier, amyloid, beta, peptide, 1-37, alzheimers, disease, APP, precusor, protein, Amyloid, Beta, Peptides, 7031, Tocris Bioscience
Citations for Amyloid β-Peptide (1-37) (human)
Citations are publications that use Tocris products.
Currently there are no citations for Amyloid β-Peptide (1-37) (human). Do you know of a great paper that uses Amyloid β-Peptide (1-37) (human) from Tocris? Please let us know.
Reviews for Amyloid β-Peptide (1-37) (human)
There are currently no reviews for this product. Be the first to review Amyloid β-Peptide (1-37) (human) and earn rewards!
Have you used Amyloid β-Peptide (1-37) (human)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Neurodegeneration Product Guide
A collection of over 275 products for neurodegeneration research, the guide includes research tools for the study of:
- Alzheimer's disease
- Parkinson's disease
- Huntington's disease
Alzheimer's Poster
Alzheimer's disease (AD) is a degenerative brain disease and the most common cause of dementia, affecting approximately 47 million people worldwide. Updated in 2015, this poster summarizes the structural and functional changes observed in the progression of this neurodegenerative disease, as well as classic AD drug targets.