Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewAmylin (rat) is a potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors (pEC50 values are 7.06-9.50 at hCTa, 8.11 at rCTa, 7.73-10.1 at hAMY1a, 9.74 at rAMY1a, 7.92 at hAMY1b, 7.78-9.9 at hAMY2a, 7.94 at hAMY2b, 8.09-10.8 at hAMY3a, 9.97 at rAMY and 8.19 at hAMY3b) receptors. Suppresses insulin-stimulated glucose uptake. Delays gastric emptying and promotes satiety. Active in vivo.
M. Wt | 3920.43 |
Formula | C167H272N52O53S2 |
Sequence |
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY (Modifications: Tyr-37 = C-terminal amide, Disulfide bridge between 2 - 7) |
Storage | Store at -20°C |
CAS Number | 124447-81-0 |
PubChem ID | 123773280 |
InChI Key | AGQDOUOEJSDDQH-BJQYWQRQSA-N |
Smiles | [H]N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 1 mg/ml in water |
References are publications that support the biological activity of the product.
Bower et al (2016) Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br.J.Pharmacol. 173 1883 PMID: 27061187
If you know of a relevant reference for Amylin (rat), please let us know.
Keywords: Amylin (rat), Amylin (rat) supplier, Potent, endogenous, peptide, agonist, amylin, calcitonin, CGRP, adrenomedullin, receptors, obesity, diabetes, satiety, Calcitonin, and, Related, Receptors, 6030, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Amylin (rat). Do you know of a great paper that uses Amylin (rat) from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Amylin (rat) and earn rewards!
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.