Amylin (rat)

Discontinued Product

Amylin (rat) (Cat. No. 6030) has been withdrawn from sale for commercial reasons.
Description: Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors
Datasheet
Citations
Reviews
Literature (1)

Biological Activity for Amylin (rat)

Amylin (rat) is a potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors (pEC50 values are 7.06-9.50 at hCTa, 8.11 at rCTa, 7.73-10.1 at hAMY1a, 9.74 at rAMY1a, 7.92 at hAMY1b, 7.78-9.9 at hAMY2a, 7.94 at hAMY2b, 8.09-10.8 at hAMY3a, 9.97 at rAMY and 8.19 at hAMY3b) receptors. Suppresses insulin-stimulated glucose uptake. Delays gastric emptying and promotes satiety. Active in vivo.

Technical Data for Amylin (rat)

M. Wt 3920.43
Formula C167H272N52O53S2
Sequence KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

(Modifications: Tyr-37 = C-terminal amide, Disulfide bridge between 2 - 7)

Storage Store at -20°C
CAS Number 124447-81-0
PubChem ID 123773280
InChI Key AGQDOUOEJSDDQH-BJQYWQRQSA-N
Smiles [H]N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

References for Amylin (rat)

References are publications that support the biological activity of the product.

Bower et al (2016) Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br.J.Pharmacol. 173 1883 PMID: 27061187

View Related Products by Product Action

View all Calcitonin and Related Receptor Agonists

Keywords: Amylin (rat), Amylin (rat) supplier, Potent, endogenous, peptide, agonist, amylin, calcitonin, CGRP, adrenomedullin, receptors, obesity, diabetes, satiety, Calcitonin, and, Related, Receptors, 6030, Tocris Bioscience

Citations for Amylin (rat)

Citations are publications that use Tocris products.

Currently there are no citations for Amylin (rat).

Reviews for Amylin (rat)

There are currently no reviews for this product. Be the first to review Amylin (rat) and earn rewards!

Have you used Amylin (rat)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.