Amylin (rat)
Biological Activity
Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors (pEC50 values are 7.06-9.50 at hCTa, 8.11 at rCTa, 7.73-10.1 at hAMY1a, 9.74 at rAMY1a, 7.92 at hAMY1b, 7.78-9.9 at hAMY2a, 7.94 at hAMY2b, 8.09-10.8 at hAMY3a, 9.97 at rAMY and 8.19 at hAMY3b) receptors. Suppresses insulin-stimulated glucose uptake. Delays gastric emptying and promotes satiety. Active in vivo.
Technical Data
M. Wt | 3920.43 |
Formula | C167H272N52O53S2 |
Sequence |
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY (Modifications: Tyr-37 = C-terminal amide, Disulfide bridge between 2 - 7) |
Storage | Store at -20°C |
CAS Number | 124447-81-0 |
PubChem ID | 123773280 |
InChI Key | AGQDOUOEJSDDQH-BJQYWQRQSA-N |
Smiles | [H]N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
Solubility | Soluble to 1 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 3920.43. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
---|---|---|---|
1 mM | 0.26 mL | 1.28 mL | 2.55 mL |
5 mM | 0.05 mL | 0.26 mL | 0.51 mL |
10 mM | 0.03 mL | 0.13 mL | 0.26 mL |
50 mM | 0.01 mL | 0.03 mL | 0.05 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Bower et al (2016) Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br.J.Pharmacol. 173 1883 PMID: 27061187
If you know of a relevant reference for Amylin (rat), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Amylin (rat), supplier, Potent, endogenous, peptide, agonist, amylin, calcitonin, CGRP, adrenomedullin, receptors, obesity, diabetes, satiety, Calcitonin, and, Related, Receptors, Calcitonin, and, Related, Receptors, Tocris Bioscience
Citations for Amylin (rat)
Citations are publications that use Tocris products.
Currently there are no citations for Amylin (rat). Do you know of a great paper that uses Amylin (rat) from Tocris? If so please let us know.
Reviews for Amylin (rat)
There are currently no reviews for this product. Be the first to review Amylin (rat) and earn rewards!
Have you used Amylin (rat)?
Submit a review and receive an Amazon gift card.
$10US/$10CAN/€7/£6 gift card for a review without an image
$25US/$25CAN/€18/£15 gift card for a review with an image
*Offer only valid in the USA / Canada, UK and Europe
Submit a ReviewLiterature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.