Amyloid β-peptide (1-42) (rat)

Cat. No. 2425

Amyloid b-peptide (1-42) (rat) Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Price and Availability

For Amyloid β-peptide (1-42) (rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Rat form of the predominant amyloid β-peptide found in plaques associated with Alzheimer's disease. Leads to a large shift in the bax/bcl-2 ratio in favour of pro-apoptotic bax. Neurotoxic.

Technical Data

M.Wt:
4417.99
Formula:
C199H307N53O59S
Sequence:
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Solubility:
Soluble to 1 mg/ml in 0.1% Ammonia
Storage:
Desiccate at -20°C
CAS No:
166090-74-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Certificate of Analysis / Product Datasheet
Select another batch:

Clementi et al (2006) Alzheimer's amyloid β-peptide (1-42) induces cell death in human neuroblastoma via bax/bcl-2 ratio increase: An intriguing role for methionine 35. Biochem.Biophys.Res.Comm. 342 206.

Van Nostrand et al (1996) Amyloid β-protein induces the cerebrovascular cellular pathology of Alzheimer's disease and related disorders. Ann.N.Y.Acad.Sci. 777 297. PMID: 8624102.

Glenner and Wong (1984) Alzheimer's disease: initial report of the purification and characterization of a novel cerebrovascular amyloid protein. Biochem.Biophys.Res.Comm. 120 885.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Amyloid β-peptide (1-42) (rat) include:

Yulei et al (2016) Partial Amelioration of Synaptic and Cognitive Deficits by Inhibiting Cofilin Dephosphorylation in an Animal Model of Alzheimer's Disease Journal of Alzheimer's Disease 53 1419. PMID: 27372643.

Do you know of a great paper that uses Amyloid β-peptide (1-42) (rat) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Amyloid b-peptide (1-42) (rat), supplier, Amyloid, β-protein, beta-protein, fragment, β-Amyloid, beta-Amyloid, b-amyloid, Precursor, Protein, APP, Secretase, beta, Peptides, β-peptide, beta-peptide, 1-42, (rat), amyloidbeta, amyloidb, amyloidβ, Tocris Bioscience, Amyloid β Peptide products

Quick Order

Find multiple products by catalog number

divider line

Neurodegeneration Research Product Guide

Neurodegeneration Product Guide

Our Neurodegeneration guide highlights over 275 products for neurodegeneration research. Request copy or view PDF today.

divider line

Alzheimer's Disease: Neurobiology and Drug Targets

Written by Alan Palmer

Alzheimer's Life Science Poster

Our Alzheimer's disease poster summarizes the structural and functional changes observed in the progression of this neurodegenerative disease. Request copy or view PDF today.

divider line

New Products in this Area

Pladienolide B

mRNA splicing inhibitor; antitumor

Lin28 1632

RNA binding protein Lin28 inhibitor; promotes mESC differentiation; also bromodomain inhibitor

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.