Nogo-66 (1-40)

Pricing Availability   Qty
Cat.No. 1984 - Nogo-66 (1-40) | Ac-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2 | CAS No. 475221-20-6
Description: Competitive antagonist for Nogo-66 receptor; promotes neuron regeneration
Alternative Names: NEP1-40, Nogo Extracellular Peptide, 1-40
Datasheet
Citations
Reviews
Literature (1)

Biological Activity

Peptide fragment corresponding to residues 1 - 40 of Nogo-66, the domain of the myelin protein Nogo that inhibits axonal outgrowth. Acts as a competitive antagonist at the Nogo-66 receptor (NgR); blocks Nogo-66- and CNS myelin-induced inhibition of axonal growth, but does not reduce myelin-associated glycoprotein (MAG) inhibition of neurite outgrowth in vitro. Promotes regeneration of hemisected spinal axons and locomotor recovery following spinal injury in vivo.

Technical Data

M. Wt 4625.16
Formula C206H324N56O65
Sequence RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS

(Modifications: Arg-1 = N-terminal Ac, Ser-40 = C-terminal amide)

Storage Desiccate at -20°C
CAS Number 475221-20-6
PubChem ID 16142739
InChI Key OLEKMOOQFWTQGD-SJQNMCRDSA-N
Smiles CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC1=CNC=N1)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(C)=O)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data

Solubility Soluble to 1 mg/ml in water

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:

References

References are publications that support the biological activity of the product.

GrandPre et al (2002) Nogo-66 receptor antagonist peptide promotes axonal regeneration. Nature 417 547 PMID: 12037567

Liu et al (2002) Myelin-associated glycoprotein as a functional ligand for the Nogo-66 receptor. Science 297 1190 PMID: 12089450

Li and Strittmatter (2003) Delayed systemic Nogo-66 receptor antagonist promotes recovery from spinal cord injury. J.Neurosci. 23 4219 PMID: 12764110


If you know of a relevant reference for Nogo-66 (1-40), please let us know.

Keywords: Nogo-66 (1-40), Nogo-66 (1-40) supplier, Competitive, antagonists, Nogo-66, receptor, NGR, neuron, regeneration, NEP140, NEP1-40, Nogo, Extracellular, Peptide,, 1-40, Neuronal, Metabolism, 1984, Tocris Bioscience

Citations for Nogo-66 (1-40)

Citations are publications that use Tocris products.

Currently there are no citations for Nogo-66 (1-40). Do you know of a great paper that uses Nogo-66 (1-40) from Tocris? Please let us know.

Reviews for Nogo-66 (1-40)

There are currently no reviews for this product. Be the first to review Nogo-66 (1-40) and earn rewards!

Have you used Nogo-66 (1-40)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


New Product Guide

New Product Guide [Spring/Summer 2019]

Our new product guide highlights over 215 new products added to the Tocris Bioscience range during the first half of 2019.

  • 7-TM Receptors
  • Enzymes
  • Enzyme-Linked Receptors
  • Ion Channels
  • Nuclear Receptors
  • Transporters
  • Chemogenetics
  • Epigenetics
  • Fluorescent Imaging
  • PROTACs
  • Signal Transduction
  • Stem Cells