Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewEndogenous insulin receptor agonist (Ki = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.
M. Wt | 5807.57 |
Formula | C257H383N65O77S6 |
Sequence |
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT* (Modifications: Disulfide bridge between 6 - 11, 7 -7*, 20 - 19*) |
Storage | Store at -20°C |
CAS Number | 11061-68-0 |
PubChem ID | 44379551 |
InChI Key | YZSPVSFRBZGLIZ-QIJQHHJSSA-N |
Smiles | [H]NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC2=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC2=CNC=N2)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N[H])CC2=CC=CC=C2)C(C)C)C(C)C)C(C)C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=C(O)C=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)NC1=O)[C@@H](C)O)[C@@H](C)CC |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 10 mg/ml in aq. HCl (pH 2.0 - 2.5) |
References are publications that support the biological activity of the product.
Torlinska et al (2000) Age dependent changes of Ins receptors in rat tissues. J.Physiol.Pharmacol. 51 871 PMID: 11220495
Ou et al (2001) The binding characteristics of Ins-MTX to Ins receptor. Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao. 32 538 PMID: 12528542
Leney and Tavare (2009) The molecular basis of Ins-stimulated glucose uptake: signalling, trafficking and potential drug targets. J.Endocrinol. 203 1 PMID: 19389739
If you know of a relevant reference for Insulin (human) recombinant
expressed in yeast, please let us know.
Keywords: Insulin (human) recombinant, expressed in yeast, Insulin (human) recombinant, expressed in yeast supplier, Endogenous, peptide, agonists, IGF, Receptors, nsulin-like, Receptor, Tyrosine, Kinases, RTKs, Insulin, and, insulin-like, Insulin-like, 3435, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for Insulin (human) recombinant
expressed in yeast include:
Dodd et al (2018) ins. regulates POMC neuronal plasticity to control glucose metabolism. Elife 7 PMID: 30230471
Stretton et al (2015) GSK3-mediated raptor phosphorylation supports amino-acid-dependent mTORC1-directed signalling. Br J Pharmacol 470 207 PMID: 26348909
Pinheiro et al (2016) Hierarchical glucocorticoid-endocannabinoid interplay regulates the activation of the nucleus accumbens by insulin. Brain.Res.Bull. 124 222 PMID: 27208730
Do you know of a great paper that uses Insulin (human) recombinant
expressed in yeast from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to
review Insulin (human) recombinant
expressed in yeast and earn rewards!
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.