Insulin (human) recombinant
expressed in yeast

Pricing Availability   Qty
Cat.No. 3435 - Insulin (human) recombinant, expressed in yeast | Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn  Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr* (Disulfide bridge = 6 - 11, 7 -7*, 20 - 19*) | CAS No. 11061-68-0
Description: Endogenous peptide agonist
Datasheet
Citations (1)
Reviews
Literature
Pathways

Biological Activity

Endogenous insulin receptor agonist (Ki = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.

Technical Data

M. Wt 5807.57
Formula C257H383N65O77S6
Sequence GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT*

(Modifications: Disulfide bridge between 6 - 11, 7 -7*, 20 - 19*)

Storage Store at -20°C
CAS Number 11061-68-0
PubChem ID 44379551
InChI Key YZSPVSFRBZGLIZ-QIJQHHJSSA-N
Smiles [H]NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC2=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC2=CNC=N2)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N[H])CC2=CC=CC=C2)C(C)C)C(C)C)C(C)C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=C(O)C=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)NC1=O)[C@@H](C)O)[C@@H](C)CC

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data

Solubility Soluble to 20 mg/ml in 0.01 M hydrochloric acid

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:

References

References are publications that support the biological activity of the product.

Torlinska et al (2000) Age dependent changes of Ins receptors in rat tissues. J.Physiol.Pharmacol. 51 871 PMID: 11220495

Ou et al (2001) The binding characteristics of Ins-MTX to Ins receptor. Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao. 32 538 PMID: 12528542

Leney and Tavare (2009) The molecular basis of Ins-stimulated glucose uptake: signalling, trafficking and potential drug targets. J.Endocrinol. 203 1 PMID: 19389739


If you know of a relevant reference for Insulin (human) recombinant
expressed in yeast, please let us know.

View Related Products by Product Action

View all Insulin and Insulin-like Receptor Activators

Keywords: Insulin (human) recombinant, expressed in yeast, Insulin (human) recombinant, expressed in yeast supplier, Endogenous, peptide, agonists, IGF, Receptors, nsulin-like, Receptor, Tyrosine, Kinases, RTKs, Insulin, and, insulin-like, Insulin-like, 3435, Tocris Bioscience

1 Citation for Insulin (human) recombinant
expressed in yeast

Citations are publications that use Tocris products. Selected citations for Insulin (human) recombinant
expressed in yeast include:

Stretton et al (2015) GSK3-mediated raptor phosphorylation supports amino-acid-dependent mTORC1-directed signalling. Br J Pharmacol 470 207 PMID: 26348909


Do you know of a great paper that uses Insulin (human) recombinant
expressed in yeast from Tocris? Please let us know.

Reviews for Insulin (human) recombinant
expressed in yeast

There are currently no reviews for this product. Be the first to review Insulin (human) recombinant
expressed in yeast
and earn rewards!

Have you used Insulin (human) recombinant
expressed in yeast?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Kinases

Kinases Product Listing

A collection of over 400 products for kinase research, the listing includes inhibitors of:

  • Receptor Tyrosine Kinases
  • Protein Kinases A, C, D and G
  • PI-3 Kinase, Akt and mTOR
  • MAPK Signaling
  • Receptor Serine/Threonine Kinases
Peptides Involved in Appetite Modulation

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.

Angiogenesis in Cancer

Angiogenesis in Cancer Poster

Adapted from the 2015 Cancer Product Guide, Edition 3, this poster summarizes the pathogenesis of angiogenesis in cancer, as well as some of the main angiogenesis therapeutic targets.

Pathways for Insulin (human) recombinant
expressed in yeast

Insulin

Insulin Signaling Pathway

Signaling through the insulin pathway is fundamental for the regulation of intracellular glucose levels. This pathway can become dysregulated in diabetes.