Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewGRF (ovine)
Discontinued Product
GRF (ovine) (Cat. No. 1187) has been withdrawn from sale for commercial reasons.
Description: Endogenous ghrelin receptor agonist
Alternative Names: Growth Hormone-Releasing Factor (ovine)
Biological Activity for GRF (ovine)
Hypothalamic peptide which stimulates the release of growth hormone.
Licensing Information
Sold with the permission of the SALK Institute
Technical Data for GRF (ovine)
| M. Wt | 5123 |
| Formula | C221H368N72O66S |
| Sequence |
YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL (Modifications: Leu-44 = C-terminal amide) |
| Storage | Desiccate at -20°C |
| Smiles | [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for GRF (ovine)
References for GRF (ovine)
References are publications that support the biological activity of the product.
Campbell et al (1991) GRF analogs and fragments: correlation between receptor binding, activity and structure. Peptides 12 569 PMID: 1656403
Campbell and Scanes (1992) Evolution of the GH-releasing factor (GRF) family of peptides. Growth Regul. 2 175 PMID: 1290954
Laburthe et al (1996) Receptors for VIP, PACAP, Secr., GRF, glucagon, GLP-1, and other members of their new family of G protein-linked receptors: structure-function relationship with special reference to the human VIP-1 receptor. Ann.N.Y.Acad.Sci. 805 94 PMID: 8993396
View Related Products by Target
View Related Products by Product Action
Keywords: GRF (ovine), GRF (ovine) supplier, Stimulates, growth, hormone, release, GHRH, Receptors, GRF, Growth-Hormone, Releasing, Hormone, Glucagon, agonists, Growth, Hormone-Releasing, Factor, (ovine), Ghrelin, 1187, Tocris Bioscience
Citations for GRF (ovine)
Citations are publications that use Tocris products.
Currently there are no citations for GRF (ovine).
Reviews for GRF (ovine)
There are currently no reviews for this product. Be the first to review GRF (ovine) and earn rewards!
Have you used GRF (ovine)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
GPCR Product Listing
A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:
- Rhodopsin-like Receptors
- Glutamate Receptors
- Frizzled Receptors
- GPCR Signaling
Peptide Hormone Receptors Product Listing
A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:
- Anterior Pituitary Regulation
- Blood Pressure Regulation
- Feeding and Appetite Regulation
- Glucose Regulation
- Peptide Hormone Processing
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.