GRF (ovine)

Discontinued Product

GRF (ovine) (Cat. No. 1187) has been withdrawn from sale for commercial reasons.
Description: Endogenous ghrelin receptor agonist
Alternative Names: Growth Hormone-Releasing Factor (ovine)
Datasheet
Citations
Reviews
Literature (1)

Biological Activity for GRF (ovine)

Hypothalamic peptide which stimulates the release of growth hormone.

Licensing Information

Sold with the permission of the SALK Institute

Technical Data for GRF (ovine)

M. Wt 5123
Formula C221H368N72O66S
Sequence YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL

(Modifications: Leu-44 = C-terminal amide)

Storage Desiccate at -20°C
Smiles [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for GRF (ovine)

Certificate of Analysis / Product Datasheet
Select another batch:

References for GRF (ovine)

References are publications that support the biological activity of the product.

Campbell et al (1991) GRF analogs and fragments: correlation between receptor binding, activity and structure. Peptides 12 569 PMID: 1656403

Campbell and Scanes (1992) Evolution of the GH-releasing factor (GRF) family of peptides. Growth Regul. 2 175 PMID: 1290954

Laburthe et al (1996) Receptors for VIP, PACAP, Secr., GRF, glucagon, GLP-1, and other members of their new family of G protein-linked receptors: structure-function relationship with special reference to the human VIP-1 receptor. Ann.N.Y.Acad.Sci. 805 94 PMID: 8993396

View Related Products by Product Action

View all Ghrelin Receptor Agonists

Keywords: GRF (ovine), GRF (ovine) supplier, Stimulates, growth, hormone, release, GHRH, Receptors, GRF, Growth-Hormone, Releasing, Hormone, Glucagon, agonists, Growth, Hormone-Releasing, Factor, (ovine), Ghrelin, 1187, Tocris Bioscience

Citations for GRF (ovine)

Citations are publications that use Tocris products.

Currently there are no citations for GRF (ovine).

Reviews for GRF (ovine)

There are currently no reviews for this product. Be the first to review GRF (ovine) and earn rewards!

Have you used GRF (ovine)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.