R&D Systems Inc. Tocris Bioscience Boston Biochem

Nogo-66 (1-40)

Cat. No. 1984

Nogo-66 (1-40) Ac-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2

Price and Availability

For Nogo-66 (1-40) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Names: NEP1-40, Nogo Extracellular Peptide, 1-40

Biological Activity

Peptide fragment corresponding to residues 1 - 40 of Nogo-66, the domain of the myelin protein Nogo that inhibits axonal outgrowth. Acts as a competitive antagonist at the Nogo-66 receptor (NgR); blocks Nogo-66- and CNS myelin-induced inhibition of axonal growth, but does not reduce myelin-associated glycoprotein (MAG) inhibition of neurite outgrowth in vitro. Promotes regeneration of hemisected spinal axons and locomotor recovery following spinal injury in vivo.

Technical Data

M.Wt:
4625.16
Formula:
C206H324N56O65
Sequence:
RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS

(Modifications: Arg-1 = N-terminal Ac, Ser-40 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
475221-20-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

GrandPre et al (2002) Nogo-66 receptor antagonist peptide promotes axonal regeneration. Nature 417 547. PMID: 12037567.

Liu et al (2002) Myelin-associated glycoprotein as a functional ligand for the Nogo-66 receptor. Science 297 1190. PMID: 12089450.

Li and Strittmatter (2003) Delayed systemic Nogo-66 receptor antagonist promotes recovery from spinal cord injury. J.Neurosci. 23 4219. PMID: 12764110.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: Nogo-66 (1-40), supplier, Competitive, antagonists, Nogo-66, receptor, NGR, neuron, regeneration, NEP140

Quick Order

Find multiple products by catalog number

divider line

New Product E-alerts

Sign up for email updates from Tocris

e-alerts

Enter your email address below to sign up to receive our email updates:

divider line

New Products in this Area

T2AA

PCNA inhibitor

SEN 1269

Amyloid-β aggregation inhibitor

Sign-up for new product e-alerts
divider line

Bio-Techne Events

EMBO 2015

The 6th EMBO Meeting 2015

September 5 - 8, 2015

Birmingham, UK