We're moving to rndsystems.com. Come with us!

After July 31, 2026, Tocris Bioscience products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Nogo-66 (1-40)

Discontinued Product

1984 has been discontinued.

View all Neuronal Metabolism products.
Description: Competitive antagonist for Nogo-66 receptor; promotes neuron regeneration
Alternative Names: NEP1-40,Nogo Extracellular Peptide,1-40
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews

Biological Activity for Nogo-66 (1-40)

Nogo-66 (1-40) is a peptide fragment corresponding to residues 1 - 40 of Nogo-66, the domain of the myelin protein Nogo that inhibits axonal outgrowth. Acts as a competitive antagonist at the Nogo-66 receptor (NgR); blocks Nogo-66- and CNS myelin-induced inhibition of axonal growth, but does not reduce myelin-associated glycoprotein (MAG) inhibition of neurite outgrowth in vitro. Promotes regeneration of hemisected spinal axons and locomotor recovery following spinal injury in vivo.

Technical Data for Nogo-66 (1-40)

M. Wt 4625.16
Formula C206H324N56O65
Sequence RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS

(Modifications: Arg-1 = N-terminal Ac, Ser-40 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 475221-20-6
PubChem ID 16142739
InChI Key OLEKMOOQFWTQGD-SJQNMCRDSA-N
Smiles CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC1=CNC=N1)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(C)=O)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for Nogo-66 (1-40)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Nogo-66 (1-40)

References are publications that support the biological activity of the product.

GrandPre et al (2002) Nogo-66 receptor antagonist peptide promotes axonal regeneration. Nature 417 547 PMID: 12037567

Liu et al (2002) Myelin-associated glycoprotein as a functional ligand for the Nogo-66 receptor. Science 297 1190 PMID: 12089450

Li and Strittmatter (2003) Delayed systemic Nogo-66 receptor antagonist promotes recovery from spinal cord injury. J.Neurosci. 23 4219 PMID: 12764110

Keywords: Nogo-66 (1-40), Nogo-66 (1-40) supplier, Competitive, antagonists, Nogo-66, receptor, NGR, neuron, regeneration, NEP140, NEP1-40, Nogo, Extracellular, Peptide,, 1-40, Neuronal, Metabolism, 1984, Tocris Bioscience

Citations for Nogo-66 (1-40)

Citations are publications that use Tocris products.

Currently there are no citations for Nogo-66 (1-40).

Reviews for Nogo-66 (1-40)

There are currently no reviews for this product. Be the first to review Nogo-66 (1-40) and earn rewards!

Have you used Nogo-66 (1-40)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review