R&D Systems Inc. Tocris Bioscience Boston Biochem

Nogo-66 (1-40)

Cat. No. 1984

Nogo-66 (1-40) Ac-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2

Price and Availability

For Nogo-66 (1-40) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Names: NEP1-40, Nogo Extracellular Peptide, 1-40

Biological Activity

Peptide fragment corresponding to residues 1 - 40 of Nogo-66, the domain of the myelin protein Nogo that inhibits axonal outgrowth. Acts as a competitive antagonist at the Nogo-66 receptor (NgR); blocks Nogo-66- and CNS myelin-induced inhibition of axonal growth, but does not reduce myelin-associated glycoprotein (MAG) inhibition of neurite outgrowth in vitro. Promotes regeneration of hemisected spinal axons and locomotor recovery following spinal injury in vivo.

Technical Data

M.Wt:
4625.16
Formula:
C206H324N56O65
Sequence:
RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS

(Modifications: Arg-1 = N-terminal Ac, Ser-40 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
475221-20-6

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

GrandPre et al (2002) Nogo-66 receptor antagonist peptide promotes axonal regeneration. Nature 417 547. PMID: 12037567.

Liu et al (2002) Myelin-associated glycoprotein as a functional ligand for the Nogo-66 receptor. Science 297 1190. PMID: 12089450.

Li and Strittmatter (2003) Delayed systemic Nogo-66 receptor antagonist promotes recovery from spinal cord injury. J.Neurosci. 23 4219. PMID: 12764110.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: Nogo-66 (1-40), supplier, Competitive, antagonists, Nogo-66, receptor, NGR, neuron, regeneration, NEP140

Quick Order

Find multiple products by catalog number

divider line

New Product E-alerts

Sign up for email updates from Tocris

Sign-up for New Product E-alerts

Enter your email address below to sign up to receive our email updates:

divider line

New Products in this Area

BMS 309403

Potent and selective FABP4 inhibitor

Sign-up for new product e-alerts
divider line

Bio-Techne Events

Neuroscience 2014

Neuroscience 2014

November 15 - 19, 2014

Washington D.C., USA