Nogo-66 (1-40)

Cat. No. 1984

Nogo-66 (1-40) Ac-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2

Price and Availability

For Nogo-66 (1-40) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Names: NEP1-40, Nogo Extracellular Peptide, 1-40

Biological Activity

Peptide fragment corresponding to residues 1 - 40 of Nogo-66, the domain of the myelin protein Nogo that inhibits axonal outgrowth. Acts as a competitive antagonist at the Nogo-66 receptor (NgR); blocks Nogo-66- and CNS myelin-induced inhibition of axonal growth, but does not reduce myelin-associated glycoprotein (MAG) inhibition of neurite outgrowth in vitro. Promotes regeneration of hemisected spinal axons and locomotor recovery following spinal injury in vivo.

Technical Data

M.Wt:
4625.16
Formula:
C206H324N56O65
Sequence:
RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS

(Modifications: Arg-1 = N-terminal Ac, Ser-40 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
475221-20-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

GrandPre et al (2002) Nogo-66 receptor antagonist peptide promotes axonal regeneration. Nature 417 547. PMID: 12037567.

Liu et al (2002) Myelin-associated glycoprotein as a functional ligand for the Nogo-66 receptor. Science 297 1190. PMID: 12089450.

Li and Strittmatter (2003) Delayed systemic Nogo-66 receptor antagonist promotes recovery from spinal cord injury. J.Neurosci. 23 4219. PMID: 12764110.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Nogo-66 (1-40), supplier, Competitive, antagonists, Nogo-66, receptor, NGR, neuron, regeneration, NEP140, Tocris Bioscience, Neuronal Metabolism

Quick Order

Find multiple products by catalog number

divider line

New Product Guide

NPG

Highlights 130 new products added in the first half of 2015. View PDF today.

divider line

New Products in this Area

NQTrp

Potent inhibitor of Aβ oligomer and fibril formation

LDN 193188

Inhibitor of phosphatidylcholine transfer protein (PC-TP)

Hydroxychloroquine sulfate

Autophagy inhibitor; also TLR9 inhibitor

Sign-up for new product e-alerts
divider line

Bio-Techne Events

ASN 2016

ASN 2016

March 19 - 23, 2016

Denver, CO, USA