R&D Systems Inc. Tocris Bioscience Boston Biochem

Glucagon-like peptide 1 (1-37) (human, rat)

Cat. No. 1851

Glucagon-like peptide 1 (1-37) (human, rat) His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Price and Availability

For Glucagon-like peptide 1 (1-37) (human, rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: GLP-1 (1-37) amide

Biological Activity

Pancreatic hormone synthesized by post-translational processing of proglucagon. Unlike truncated forms of GLP-1, it has no effect on food intake in rats and does not enhance pancreatic insulin secretion. However it induces insulin expression in intestinal epithelial cells, which can restore glucose homeostasis when implanted into diabetic mice.

Technical Data

M.Wt:
4169.52
Formula:
C186H275N51O59
Sequence:
HDEFERHAEGTFTSDVSSYLEGQAAKEFIA­WLVKGRG
Solubility:
Soluble to 5 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
87805-34-3

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Bell et al (1983) Exon duplication and divergence in the human preproglucagon gene. Nature 304 368. PMID: 6877358.

Navarro et al (1996) Colocalization of glucagon-like peptide-1 (GLP-1) receptors, glucose transporter GLUT-2, and glucokinase mRNAs in rat hypothalamic cells: evidence for a role of GLP-1 receptor agonists as an inhibitory signal for food and water intake. J.Neurochem. 67 1982. PMID: 8863504.

Suzuki et al (2003) Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into insulin-producing cells. Proc.Natl.Acad.Sci.USA 100 5034.

If you know of a relevant citation for this product please let us know.

Keywords: Glucagon-like peptide 1 (1-37) (human, rat), supplier, Endogenous, pancreatic, peptide, GLP1, Receptors, Glucagon-Like, Peptide, 1, Glucagon-like, peptide1, (1-37), (human, rat), GLP1(1-37), amide, diabetes

Quick Order

Find multiple products by catalog number

divider line

Appetite Modulation

Peptides Involved in Appetite Modulation Review

Written by Sonia A. Tucci, Lynsay Kobelis & Tim Kirkham. Request a copy or view PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Poster

'Gut Hormones and the Regulation of Appetite' summarizes the neuropeptide modulators and gut hormones that influence appetite

divider line

7-TM Receptor Signaling

Written by T. Kenakin et al

7-TM Poster

'Seven Transmembrane Receptor Signaling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy

divider line

New Product Guide

NPG

Highlights over 130 new products added in 2012. Request a copy or view PDF today.

divider line

Tocris Events

Win a Kindle

11th Annual Meeting of the International Society for Stem Cell Research

11th Annual Meeting of the International Society for Stem Cell Research

June 12 - 15, 2013

Boston, MA

Booth Number: 213