R&D Systems Inc. Tocris Bioscience Boston Biochem

Margatoxin

Cat. No. 3563

Margatoxin Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His     (Disulfide bridges: 7 - 29, 13 - 34, 17 - 36)

Price and Availability

For Margatoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: MgTX

Biological Activity

Potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Technical Data

M.Wt:
4178.96
Formula:
C178H286N52O50S7
Sequence:
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

(Modifications: Disulfide bridge between 7 - 29, 13 - 34, 17 - 36)

Solubility:
Soluble to 0.50 mg/ml in water
Storage:
Store at -20°C
CAS No:
145808-47-5

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Garcia-Calvo et al (1993) Purification, characterization, and biosynthesis of Margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J.Biol.Chem. 268 18866. PMID: 8360176.

Erdogan et al (2005) Margatoxin inhibits VEGF-induced hyperpolarization, proliferation and nitric oxide production of human endothelial cells. J.Vasc.Res. 42 368. PMID: 16043967.

If you know of a relevant citation for this product please let us know.

Keywords: Margatoxin, supplier, Kv1.3, channel, blocker, voltage-gated, potassium, channels, MgTX, MTX

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Guide

Highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Peripheral Sensitization

Written by Grant D. Nicol and Michael R. Vasko

Pain Poster

A summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request a copy or view PDF today.

divider line

New Product Guide

NPG

Highlights 140 new products added in the first half of 2014. Request a copy or view PDF today.

divider line

New Products in this Area

TRAM 39

Potent KCa3.1 blocker

BDS I

Potent and reversible Kv3.4 potassium channel blocker; neuroprotective

Agitoxin 2

Potent Shaker K+ channel blocker

MaxiPost

Potassium channel modulator; exerts subtype-specific effects

ML 277

Selective Kv7.1 (KCNQ1) potassium channel activator; augments IKs current

Sign-up for new product e-alerts
divider line

Bio-Techne Events

Neuroscience 2014

Neuroscience 2014

November 15 - 19, 2014

Washington D.C., USA