Margatoxin

Cat. No. 3563

Margatoxin Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His     (Disulfide bridges: 7 - 29, 13 - 34, 17 - 36)

Price and Availability

For Margatoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: MgTX

Biological Activity

Potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Technical Data

M.Wt:
4178.96
Formula:
C178H286N52O50S7
Sequence:
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

(Modifications: Disulfide bridge between 7 - 29, 13 - 34, 17 - 36)

Solubility:
Soluble to 0.50 mg/ml in water
Storage:
Store at -20°C
CAS No:
145808-47-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Garcia-Calvo et al (1993) Purification, characterization, and biosynthesis of Margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J.Biol.Chem. 268 18866. PMID: 8360176.

Erdogan et al (2005) Margatoxin inhibits VEGF-induced hyperpolarization, proliferation and nitric oxide production of human endothelial cells. J.Vasc.Res. 42 368. PMID: 16043967.

If you know of a relevant citation for this product please let us know.

View Related Products by Product Action

Keywords: Margatoxin, supplier, Kv1.3, channel, blocker, voltage-gated, potassium, channels, MgTX, MTX, Tocris Bioscience, Voltage-gated Potassium (KV) Channel Blockers

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Peripheral Sensitization

Written by Grant D. Nicol and Michael R. Vasko

Pain Life Science Poster

A summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request copy or view PDF today.

divider line

New Products in this Area

Guangxitoxin 1E

Potent Kv2.1 and Kv2.2 channel blocker

AmmTX3

KV4 channel blocker

Sign-up for new product e-alerts
divider line

Bio-Techne Events

TOX EXPO

The Society of Toxicology's 55th Annual Meeting and ToxExpo

March 14 - 16, 2016

New Orleans, LA, USA