R&D Systems Inc. Tocris Bioscience Boston Biochem

Margatoxin

Cat. No. 3563

Margatoxin Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His     (Disulfide bridges: 7 - 29, 13 - 34, 17 - 36)

Price and Availability

For Margatoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: MgTX

Biological Activity

Potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Technical Data

M.Wt:
4178.96
Formula:
C178H286N52O50S7
Sequence:
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

(Modifications: Disulfide bridge between 7 - 29, 13 - 34, 17 - 36)

Solubility:
Soluble to 0.50 mg/ml in water
Storage:
Store at -20°C
CAS No:
145808-47-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Garcia-Calvo et al (1993) Purification, characterization, and biosynthesis of Margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J.Biol.Chem. 268 18866. PMID: 8360176.

Erdogan et al (2005) Margatoxin inhibits VEGF-induced hyperpolarization, proliferation and nitric oxide production of human endothelial cells. J.Vasc.Res. 42 368. PMID: 16043967.

If you know of a relevant citation for this product please let us know.

Keywords: Margatoxin, supplier, Kv1.3, channel, blocker, voltage-gated, potassium, channels, MgTX, MTX

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Guide

Highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Guide

Highlights over 250 products for cardiovascular research. Request a copy or view PDF today.

divider line

Peripheral Sensitization

Written by Grant D. Nicol and Michael R. Vasko

Pain Poster

A summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request a copy or view PDF today.

divider line

New Product Guide

NPG

Highlights 130 new products added in the first half of 2015. View PDF today.

divider line

New Products in this Area

PK-THPP

Potent TASK-3 channel blocker

ML 297

Selective Kir3.1/3.2 (GIRK1/2) channel activator

ML 365

Potent and selective TASK-1 channel blocker

HMR 1556

Potent and selective Iks channel blocker

NS 19504

Activator of BKCa (KCa1.1) channels

Sign-up for new product e-alerts
divider line

Bio-Techne Events

FEBS 2015

40th FEBS Congress: The Biochemical Basis of Life

July 4 - 9, 2015

Berlin, Germany