R&D Systems Inc. Tocris Bioscience Boston Biochem

Margatoxin

Cat. No. 3563

Margatoxin Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His     (Disulfide bridges: 7 - 29, 13 - 34, 17 - 36)

Price and Availability

For Margatoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: MgTX

Biological Activity

Potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Technical Data

M.Wt:
4178.96
Formula:
C178H286N52O50S7
Sequence:
TIINVKCTSPKQCLPPCKAQFGQSAGAKCM­NGKCKCYPH

(Modifications: Disulfide bridge between 7 - 29, 13 - 34, 17 - 36)

Solubility:
Soluble to 0.50 mg/ml in water
Storage:
Store at -20°C
CAS No:
145808-47-5

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Garcia-Calvo et al (1993) Purification, characterization, and biosynthesis of Margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J.Biol.Chem. 268 18866. PMID: 8360176.

Erdogan et al (2005) Margatoxin inhibits VEGF-induced hyperpolarization, proliferation and nitric oxide production of human endothelial cells. J.Vasc.Res. 42 368. PMID: 16043967.

If you know of a relevant citation for this product please let us know.

Keywords: Margatoxin, supplier, Kv1.3, channel, blocker, voltage-gated, potassium, channels, MgTX, MTX

Quick Order

Find multiple products by catalog number

divider line

Pain Research Guide

Reserve your free copy

Pain Research Guide

Highlights over 280 products for Pain research. Reserve copy

divider line

New Product Guide

NPG

Highlights over 130 new products added in 2012. Request a copy or view PDF today.

divider line

New Products in this Area

NS 6180

Potent KCa3.1 channel blocker

ADWX 1

Potent and selective KV1.3 channel blocker

Cesium chloride

Potassium channel blocker; neuroprotective

Sign-up for new product e-alerts
divider line

20% Discount*

Potent, selective LRRK2 inhibitor

Potent LRRK2 inhibitor now available from Tocris Bioscience

Tocris is the first to launch GSK2578215A, licensed from GlaxoSmithKline, for the study of Parkinson's Disease.

* Terms & conditions