Home » Pharmacology » 7-TM Receptors » Peptide Receptors » Protease-Activated Receptors » Parstatin (human)

Parstatin (human)

Cat No. 3553

Price and Availability

For Parstatin (human) pricing & availability please select your country from the drop down menu:
Submit

Biological Activity

Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR₁) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC₅₀ ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo.

Technical Data

M.Wt:

4467.29

Formula:

C₁₉₁H₃₃₀N₆₄O₅₃S₃

Sequence:

MGPRRLLLVAACFSLCGPLLSARTRARRPESKA TNATLDPR

Storage:

Store at -20°C

CAS No:

[1065755-99-8]

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis and MSDS.

Resources

Other Information

Parstatin (mouse) also available

Certificate of Analysis / MSDS

Certificate of Analysis: View current batch

Material Safety Data Sheet: View current batch

References

Zania et al (2009) Parstatin, the cleaved peptide on proteinase-activated receptor 1 activation, is a potent inhibitor of activation. J.Pharmacol.Exp.Ther. 328 378. Strande et al (2009) Parstatin: a cryptic peptide involved in cardioprotection after ischaemic and reperfusion injury. Cardiovasc.Res. 83 325.

If you know of a useful citation for this product please let us know.

View Related Products by Target

Peptide Receptors

Protease-Activated Receptors

Keywords: Parstatin (human), Peptide, cleaved, PAR1, receptors, activation, Protease-Activated, proteinase-activated

Buy Now / Print Quote

Find multiple products by catalog number

Print Quote Facility

Order via your purchasing department

It's now even easier to place orders via your purchasing department.

Simply add a product to your cart & click on the "Print Quote" button.

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

'Regulation of Vascular Reactivity by G-protein-coupled Receptors' summarizes the key GPCRs regulating vascular reactivity.

7-TM Receptor Signalling

Written by T. Kenakin et al

'Seven Transmembrane Receptor Signalling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy

GPCRs and Signalling Networks

Written by M.J. Marinissen

'G-Protein-coupled Receptors and Signalling Networks' summarizes the intricate network of intracellular signalling pathways involved in GPCR function.