We're moving to rndsystems.com. Come with us!

After July 31, 2026, Tocris Bioscience products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Amyloid β-peptide (42-1) (human)

Discontinued Product

3391 has been discontinued.

Description: Inactive control peptide for amyloid β-peptide (1-42) (Cat. No. 1428)
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews
Literature (1)

Biological Activity for Amyloid β-peptide (42-1) (human)

Amyloid β-peptide (42-1) (human) is an inactive control peptide for amyloid β-peptide (1-42), the predominant form of amyloid β-peptide found in the brains of patients with Alzheimer's disease.

Active Analog also available.

Technical Data for Amyloid β-peptide (42-1) (human)

M. Wt 4514.08
Formula C203H311N55O60S
Sequence AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 317366-82-8
PubChem ID 16132430
InChI Key PLOPBXQQPZYQFA-AXPWDRQUSA-N
Smiles [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for Amyloid β-peptide (42-1) (human)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Amyloid β-peptide (42-1) (human)

References are publications that support the biological activity of the product.

Walsh et al (2002) Amyloid-beta peotide is toxic to neurons in vivo via indirect mechanisms. Neurobiol.Dis. 10 20 PMID: 12079400

Xiong et al (2007) Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina. Exp.Brain Res. 181 435 PMID: 17429617

Boyd-Kimball et al (2005) Proteomic identification of proteins oxidized by Aβ(1-42) in synaptosomes: Implications for Alzheimer's disease. Brain Res. 1004 206 PMID: 15885219

View Related Products by Target

Keywords: Amyloid beta-peptide (42-1) (human), Amyloid beta-peptide (42-1) (human) supplier, Inactive, control, peptide, β-Amyloid, beta-Amyloid, b-amyoid, Precursor, Protein, APP, Secretase, beta, Peptides, Amyloid, β-peptide, beta-peptide, (42-1), (human), amyloidbeta, amyloidb, amyloidβ, Beta, 3391, Tocris Bioscience

1 Citation for Amyloid β-peptide (42-1) (human)

Citations are publications that use Tocris products. Selected citations for Amyloid β-peptide (42-1) (human) include:

Esposito et al (2011) Cannabidiol reduces Aβ-induced neuroinflammation and promotes hippocampal neurogenesis through PPARγ involvement. PLoS One 6 e28668 PMID: 22163051


Reviews for Amyloid β-peptide (42-1) (human)

There are currently no reviews for this product. Be the first to review Amyloid β-peptide (42-1) (human) and earn rewards!

Have you used Amyloid β-peptide (42-1) (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Alzheimer's Disease Poster

Alzheimer's Disease Poster

Alzheimer's disease (AD) is a debilitating and progressive neurodegenerative disease and the most common cause of dementia, affecting approximately 30% of individuals aged over 85 years. This poster summarizes the cellular and molecular mechanisms of AD.