R&D Systems Inc. Tocris Bioscience Boston Biochem

Amyloid β-peptide (42-1) (human)

Cat. No. 3391

Amyloid b-peptide (42-1) (human) Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp

Price and Availability

For Amyloid β-peptide (42-1) (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Inactive control peptide for amyloid β-peptide (1-42) (Cat. No. 1428), the predominant form of amyloid β-peptide found in the brains of patients with Alzheimer's disease.

Technical Data

M.Wt:
4514.08
Formula:
C203H311N55O60S
Sequence:
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Solubility:
Soluble to 0.50 mg/ml in water
Storage:
Store at -20°C
CAS No:
317366-82-8

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Walsh et al (2002) Amyloid-beta peotide is toxic to neurons in vivo via indirect mechanisms. Neurobiol.Dis. 10 20. PMID: 12079400.

Boyd-Kimball et al (2005) Proteomic identification of proteins oxidized by Aβ(1-42) in synaptosomes: Implications for Alzheimer's disease. Brain Res. 1004 206. PMID: 15885219.

Xiong et al (2007) Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina. Exp.Brain Res. 181 435. PMID: 17429617.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: Amyloid b-peptide (42-1) (human), supplier, Inactive, control, peptide, β-Amyloid, beta-Amyloid, b-amyoid, Precursor, Protein, APP, Secretase, beta, Peptides, Amyloid, β-peptide, beta-peptide, (42-1), (human)

Quick Order

Find multiple products by catalog number

divider line

The Neurobiology of Alzheimer's Disease

Written by Alan Palmer

Alzheimer's Poster

'The Neurobiology of Alzheimer's Disease' summarizes structural and functional changes observed in the progression of AD.

divider line

New Product Guide

NPG

Highlights 140 new products added in the first half of 2014. Request a copy or view PDF today.

divider line

New Products in this Area

BMS 309403

Potent and selective FABP4 inhibitor

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.