Home » Pharmacology » 7-TM Receptors » Peptide Receptors » PACAP Receptors » PACAP 6-38

PACAP 6-38

Cat No. 3236

Price and Availability

For PACAP 6-38 pricing & availability please select your country from the drop down menu:
Submit

Biological Activity

Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)₁ antagonist (IC₅₀ = 2nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (K_i = 1.5nM). Antitumor activity in vivo.

Technical Data

M.Wt:

4024.78

Formula:

C₁₈₂H₃₀₀N₅₆O₄₅S

Sequence:

FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

(Modifications: Lys-33 = C-terminal amide)

Storage:

Desiccate at -20°C

CAS No:

[143748-18-9]

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis and MSDS.

Resources

Certificate of Analysis / MSDS

Certificate of Analysis: View current batch

Material Safety Data Sheet: View current batch

References

Robberecht et al (1992) Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur.J.Biochem. 207 239. Leyton et al (1998) PACAP(6-38) inhibits growth of prostate cancer cells. Cancer Lett. 125 131. Kojro et al (2006) The neuropeptide PACAP promotes α-secretase pathway for processing Alzheimer amyloid precursor protein. FASEB J. 20 512.

If you know of a useful citation for this product please let us know.

View Related Products by Target

PACAP Receptors

Peptide Receptors

Keywords: PACAP 6-38, Potent, PAC1, receptors, antagonists, Pituitary, Adenylate, Cyclase, Activating, Peptide, PACAP, PACAP6-38

Buy Now / Print Quote

Find multiple products by catalog number

Print Quote Facility

Order via your purchasing department

It's now even easier to place orders via your purchasing department.

Simply add a product to your cart & click on the "Print Quote" button.

GPCRs and Signalling Networks

Written by M.J. Marinissen

'G-Protein-coupled Receptors and Signalling Networks' summarizes the intricate network of intracellular signalling pathways involved in GPCR function.

Endocrinology Guide

Highlights over 200 products for endocrinology research. Request a copy or view PDF today.

7-TM Receptor Signalling

Written by T. Kenakin et al

'Seven Transmembrane Receptor Signalling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy