PACAP 6-38

Cat. No. 3236

PACAP 6-38 Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

Price and Availability

For PACAP 6-38 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist (IC50 = 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Antitumor activity in vivo.

Technical Data

M.Wt:
4024.78
Formula:
C182H300N56O45S
Sequence:
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

(Modifications: Lys-33 = C-terminal amide)

Solubility:
Soluble to 2 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
143748-18-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Robberecht et al (1992) Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur.J.Biochem. 207 239. PMID: 1321043.

Leyton et al (1998) PACAP(6-38) inhibits growth of prostate cancer cells. Cancer Lett. 125 131. PMID: 9566707.

Kojro et al (2006) The neuropeptide PACAP promotes a-secretase pathway for processing Alzheimer amyloid precursor protein. FASEB J. 20 512. PMID: 16401644.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: PACAP 6-38, supplier, Potent, PAC1, receptors, antagonists, Pituitary, Adenylate, Cyclase, Activating, Peptide, PACAP638, Tocris Bioscience, PACAP Receptor Antagonists

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

New Products in this Area

ML 18

BRS-3 antagonist; also GRPR agonist

Quin C1

Potent and selective FPR2 agonist

RFRP-1 (human)

Potent NPFF receptor agonist

NTRC 824

Potent and selective non-peptide NTS2 antagonist

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.