R&D Systems Inc. Tocris Bioscience Boston Biochem

PACAP 6-38

Cat. No. 3236

PACAP 6-38 Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

Price and Availability

For PACAP 6-38 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist (IC50 = 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Antitumor activity in vivo.

Technical Data

M.Wt:
4024.78
Formula:
C182H300N56O45S
Sequence:
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

(Modifications: Lys-33 = C-terminal amide)

Solubility:
Soluble to 2 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
143748-18-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Safety Data Sheet: View Safety Data Sheet

References

Robberecht et al (1992) Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur.J.Biochem. 207 239. PMID: 1321043.

Leyton et al (1998) PACAP(6-38) inhibits growth of prostate cancer cells. Cancer Lett. 125 131. PMID: 9566707.

Kojro et al (2006) The neuropeptide PACAP promotes a-secretase pathway for processing Alzheimer amyloid precursor protein. FASEB J. 20 512. PMID: 16401644.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: PACAP 6-38, supplier, Potent, PAC1, receptors, antagonists, Pituitary, Adenylate, Cyclase, Activating, Peptide, PACAP638

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptor Product Listing

Highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

New Product Guide

NPG

Highlights 150 new products added in the second half of 2014. View PDF today.

divider line

New Products in this Area

TC-FPR 43

Potent FPR2 agonist

TC-G 1003

High affinity somatostatin sst2 receptor agonist

Kisspeptin 10 (dog)

Endogenous ligand for canine kisspeptin receptor

MK 0677

High affinity ghrelin receptor agonist

Urantide

Selective and competitive urotensin II antagonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

DPG 2015

BNA 2015: Festival of Neuroscience

April 12 - 15, 2015

Edinburgh, UK

Booth: 25A