Home » Cellular Processes » Extracellular Matrix and Adhesion Molecules » Cell Adhesion Molecules » Echistatin, α1 isoform

Echistatin, α1 isoform

Cat. No. 3202

Echistatin, a1 isoform Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr

Price and Availability

For Echistatin, α1 isoform pricing & availability please select your country from the drop down menu:
Submit

By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent irreversible α_Vβ₃ integrin antagonist (K_i = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC₅₀ = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, α_IIbβ₃) receptors (IC₅₀ = 30 nM) in vitro.

Technical Data

M.Wt:

5417.1

Formula:

C₂₁₇H₃₄₁N₇₁O₇₄S₉

Sequence:

ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

(Modifications: Disulfide bridge between 2 - 11, 7 - 32, 8 - 37, 20 - 39)

Solubility:

Soluble to 1 mg/ml in water

Storage:

Store at -20°C

CAS No:

154303-05-6

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Resources

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch

Select another batch:

Safety Data Sheet: View Safety Data Sheet

References

Musial et al (1990) Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 82 261. PMID: 2364514.

Sato et al (1990) Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 111 1713. PMID: 2211834.

Kumar et al (1997) Biochemical characteriation of the binding of echistatin to integrin α_Vβ₃ receptor. J.Pharmacol.Exp.Ther. 283 843. PMID: 9353406.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Cell Adhesion Molecules Extracellular Matrix and Adhesion Molecules

Integrin Receptors

Keywords: Echistatin, a1 isoform, supplier, αVβ3, alphaVβ3, beta3, glycoprotein, IIb/IIIa, αIIbβ3, alphaIIbβ3, inhibitors, Integrin, Receptors, Adhesion, Molecules, Echistatin, alpha1, isoform, Echistatina1

Quick Order

Find multiple products by catalog number

Cancer Research Guide

Request your free copy

Highlights over 350 products for cancer research. Request a copy or view PDF today.

VEGF Pathway & Anti-Angiogenic Therapy

Written by N. Ferrara & Y. Crawford

A summary of antiangiogenic therapies targeting the VEGF pathway and the mechanisms of therapy resistance.

New Product Guide

Highlights over 130 new products added in 2012. Request a copy or view PDF today.

Twitter Updates

Follow @Tocris on Twitter

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.