R&D Systems Inc. Tocris Bioscience Boston Biochem

PACAP 1-38

Cat. No. 1186

PACAP 1-38 His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

Price and Availability

For PACAP 1-38 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: Pituitary Adenylate Cyclase-Activating Polypeptide 1-38

Biological Activity

Endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP) but with a greater potency for stimulation of adenylyl cyclase.

Technical Data

M.Wt:
4535
Formula:
C203H331N63O53S
Sequence:
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

(Modifications: Lys-38 = C-terminal amide)

Solubility:
Soluble to 0.90 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
137061-48-4

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Rawlings et al (1994) Pituitary adenylate cyclase-activating polypeptide increase [Ca2+]i in rat gonadotrophs through an inositol trisphosphate-dependent mechanism. J.Biol.Chem. 269 5680. PMID: 7907085.

Lazarovici et al (1998) The 38-amino-acid form of pituitary adenylate cyclase-activating polypeptide induces neurite outgrowth in PC12 cells that is dependent on protein kinase C and extracellular signal-regulated kinase but not on protein kinase A, nerve growth factor receptor tyrosine kinase, p21ras G protein, and pp60c-src cytoplasmic tyrosine kinase. Mol.Pharmacol. 54 547. PMID: 9730914.

Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143. PMID: 9549761.

If you know of a relevant citation for this product please let us know.

Keywords: PACAP 1-38, supplier, Potently, stimulates, adenylyl, cyclases, stimulator, adenylate, Inositol, cAMP, Signaling, Signalling, Pituitary, Adenylate, Activating, Peptide, Receptors, PAC1, PACAP138

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptor Product Listing

Highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

New Product Guide

NPG

Highlights 150 new products added in the second half of 2014. View PDF today.

divider line

New Products in this Area

TC-G 1003

High affinity somatostatin sst2 receptor agonist

Kisspeptin 10 (dog)

Endogenous ligand for canine kisspeptin receptor

MK 0677

High affinity ghrelin receptor agonist

Urantide

Selective and competitive urotensin II antagonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

DPG 2015

BNA 2015: Festival of Neuroscience

April 12 - 15, 2015

Edinburgh, UK

Booth: 33