R&D Systems Inc. Tocris Bioscience Boston Biochem

PACAP 1-38

Cat. No. 1186

PACAP 1-38 His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

Price and Availability

For PACAP 1-38 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: Pituitary Adenylate Cyclase-Activating Polypeptide 1-38

Biological Activity

Endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP) but with a greater potency for stimulation of adenylyl cyclase.

Technical Data

M.Wt:
4535
Formula:
C203H331N63O53S
Sequence:
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKR­YKQRVKNK

(Modifications: Lys-38 = C-terminal amide)

Solubility:
Soluble to 0.90 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
137061-48-4

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Rawlings et al (1994) Pituitary adenylate cyclase-activating polypeptide increase [Ca2+]i in rat gonadotrophs through an inositol trisphosphate-dependent mechanism. J.Biol.Chem. 269 5680. PMID: 7907085.

Lazarovici et al (1998) The 38-amino-acid form of pituitary adenylate cyclase-activating polypeptide induces neurite outgrowth in PC12 cells that is dependent on protein kinase C and extracellular signal-regulated kinase but not on protein kinase A, nerve growth factor receptor tyrosine kinase, p21ras G protein, and pp60c-src cytoplasmic tyrosine kinase. Mol.Pharmacol. 54 547. PMID: 9730914.

Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143. PMID: 9549761.

If you know of a relevant citation for this product please let us know.

Keywords: PACAP 1-38, supplier, Potently, stimulates, adenylyl, cyclases, stimulator, adenylate, Inositol, cAMP, Signaling, Signalling, Pituitary, Adenylate, Activating, Peptide, Receptors, PAC1, PACAP138

Quick Order

Find multiple products by catalog number

divider line

7-TM Receptor Signaling

Written by T. Kenakin et al

7-TM Poster

'Seven Transmembrane Receptor Signaling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy

divider line

New Product Guide

NPG

Highlights over 130 new products added in 2012. Request a copy or view PDF today.

divider line

New Products in this Area

Carbetocin

Oxytocin analog

ML 221

Apelin receptor (APJ) antagonist

Q94 hydrochloride

Negative allosteric modulator at PAR1 receptor

FSLLRY-NH2

PAR2 peptide antagonist

SB 611812

Urotensin-II (UT) antagonist; attenuates cardiac dysfunction

TC-MCH 7c

Selective melanin-concentrating hormone receptor 1 (MCH1R) antagonist

CYM 9484

Potent NPY Y2 receptor antagonist

Sign-up for new product e-alerts
divider line

Tocris Events

Win a Kindle

11th Congress of the French Neuroscience Society

11th Congress of the French Neuroscience Society

May 21 - 24, 2013

Lyon, France

Booth Number: 32