R&D Systems Inc. Tocris Bioscience Boston Biochem

Apelin-36 (rat, mouse)

Cat. No. 2427

Apelin-36 (rat, mouse) Leu-Val-Lys-Pro-Arg-Thr-Ser-Arg-Thr-Gly-Pro-Gly-Ala-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe

Price and Availability

For Apelin-36 (rat, mouse) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data

M.Wt:
4200.93
Formula:
C185H304N68O43S
Sequence:
LVKPRTSRTGPGAWQGGRRKFRRQRPRLSH­KGPMPF
Solubility:
Soluble to 1.60 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
230299-95-3

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471.

Zou et al (2000) Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473 15. PMID: 10802050.

Kawamata et al (2001) Molecular properties of apelin: tissue distribution and receptor binding. Biochim.Biophys.Acta 1538 162. PMID: 11336787.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: Apelin-36 (rat, mouse), supplier, Endogenous, APJ, receptors, agonists, Apelin, adipokines

Quick Order

Find multiple products by catalog number

divider line

Cardiovascular Guide

Request your free copy

Cardiovascular Research Guide

Highlights over 250 products for cardiovascular research. Request a copy or view PDF today.

divider line

7-TM Receptor Signaling

Written by T. Kenakin et al

7-TM Poster

'Seven Transmembrane Receptor Signaling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy

divider line

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

Cardiovascular Poster

'Regulation of Vascular Reactivity by G-protein-coupled Receptors' summarizes the key GPCRs regulating vascular reactivity.

divider line

New Product Guide

NPG

Highlights over 130 new products added in 2012. Request a copy or view PDF today.

divider line

New Products in this Area

Carbetocin

Oxytocin analog

ML 221

Apelin receptor (APJ) antagonist

Q94 hydrochloride

Negative allosteric modulator at PAR1 receptor

FSLLRY-NH2

PAR2 peptide antagonist

SB 611812

Urotensin-II (UT) antagonist; attenuates cardiac dysfunction

TC-MCH 7c

Selective melanin-concentrating hormone receptor 1 (MCH1R) antagonist

CYM 9484

Potent NPY Y2 receptor antagonist

Sign-up for new product e-alerts
divider line

Tocris Events

Win a Kindle

11th Annual Meeting of the International Society for Stem Cell Research

11th Annual Meeting of the International Society for Stem Cell Research

June 12 - 15, 2013

Boston, MA

Booth Number: 213