Amyloid β-peptide (1-42) (rat)

Cat. No. 2425

Amyloid b-peptide (1-42) (rat) Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Price and Availability

For Amyloid β-peptide (1-42) (rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Rat form of the predominant amyloid β-peptide found in plaques associated with Alzheimer's disease. Leads to a large shift in the bax/bcl-2 ratio in favour of pro-apoptotic bax. Neurotoxic.

Technical Data

M.Wt:
4417.99
Formula:
C199H307N53O59S
Sequence:
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
166090-74-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Glenner and Wong (1984) Alzheimer's disease: initial report of the purification and characterization of a novel cerebrovascular amyloid protein. Biochem.Biophys.Res.Comm. 120 885.

Van Nostrand et al (1996) Amyloid β-protein induces the cerebrovascular cellular pathology of Alzheimer's disease and related disorders. Ann.N.Y.Acad.Sci. 777 297. PMID: 8624102.

Clementi et al (2006) Alzheimer's amyloid β-peptide (1-42) induces cell death in human neuroblastoma via bax/bcl-2 ratio increase: An intriguing role for methionine 35. Biochem.Biophys.Res.Comm. 342 206.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: Amyloid b-peptide (1-42) (rat), supplier, Amyloid, β-protein, beta-protein, fragment, β-Amyloid, beta-Amyloid, b-amyloid, Precursor, Protein, APP, Secretase, beta, Peptides, β-peptide, beta-peptide, 1-42, (rat), amyloidbeta, amyloidb, amyloidβ

Quick Order

Find multiple products by catalog number

divider line

Neurodegeneration Research Product Guide

Neurodegeneration Research Guide

Highlights over 250 products for neurodegeneration research. Request a copy or view PDF today.

divider line

The Neurobiology of Alzheimer's Disease

Written by Alan Palmer

Alzheimer's Poster

'The Neurobiology of Alzheimer's Disease' summarizes structural and functional changes observed in the progression of AD.

divider line

New Product Guide

NPG

Highlights 130 new products added in the first half of 2015. View PDF today.

divider line

New Products in this Area

TC-G 1005

Potent and selective TGR5 agonist

NSC 617145

Werner syndrome helicase (WRN) helicase inhibitor

T2AA

PCNA inhibitor

SEN 1269

Amyloid-β aggregation inhibitor

Sign-up for new product e-alerts
divider line

Bio-Techne Events

EMBO 2015

The 6th EMBO Meeting 2015

September 5 - 8, 2015

Birmingham, UK