R&D Systems Inc. Tocris Bioscience Boston Biochem

GIP (1-39)

Cat. No. 2257

GIP (1-39) Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn

Price and Availability

For GIP (1-39) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: Gastric Inhibitory Polypeptide (1-39)

Biological Activity

Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP (Cat. No 2084).

Technical Data

M.Wt:
4633.21
Formula:
C210H316N56O61S
Sequence:
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK­GKKSDWKHN
Solubility:
Soluble to 10 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
725474-97-5

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Resources

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Xie et al (2004) GIP1-39, a novel insulinotropic peptide form and aspects on its mechanism of action. Regul.Peptides 121 107.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

GIP Receptor
Glucagon and Related Receptors

Keywords: GIP (1-39), supplier, potent, insulinotropic, peptide, Gastric, inhibitory, Peptide, Receptors, Glucose-Dependent, Insulinotropic, GIP, Glucagon

Quick Order

Find multiple products by catalog number

divider line

Appetite Modulation

Peptides Involved in Appetite Modulation Review

Written by Sonia A. Tucci, Lynsay Kobelis & Tim Kirkham. Request a copy or view PDF today.

divider line

7-TM Receptor Signaling

Written by T. Kenakin et al

7-TM Poster

'Seven Transmembrane Receptor Signaling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Poster

'Gut Hormones and the Regulation of Appetite' summarizes the neuropeptide modulators and gut hormones that influence appetite

divider line

New Product Guide

NPG

Highlights over 130 new products added in 2012. Request a copy or view PDF today.

divider line

Tocris Events

Win a Kindle

event

5th Conference on Advances in Molecular Mechanisms Underlying Neurological Disorders

June 23 - 26, 2013

Bath, UK