Pharmacology
All Targets
7-TM Receptors
Ion Channels
Nuclear Receptors
Enzyme-Linked Receptors
Transporters
Enzymes
Other Pharmacology
Cellular Processes
Angiogenesis
Apoptosis
Cell Cycle
Cell Metabolism
Cytoskeleton & Motor Proteins
ECM & Adhesion Molecules
Signal Transduction
Stem Cells
Product Type
All Products
New Products
Small Molecules
Peptides
Antibodies
Jena Bioscience
Controlled Substances
Toxins
Caged Compounds
Fluorescent Probes
Screening Libraries
Ligand Sets
Other Product Types
Research Area
Cancer
Cardiovascular Disease
Endocrinology
Immunology
Metabolic Disease
Neurological Disease
Pain & Inflammation
Respiratory Disease
Home »
Pharmacology » 7-TM Receptors » Peptide Receptors » CRF Receptors » Non-selective CRF » CRF (human, rat)
CRF (human, rat)Cat No. 1151 |
Price and Availability |
|
Alternative Name: Corticotropin-ReleasingFactor (human, rat) |
|
Biological Activity
Endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.Licensing Information
Sold with the permission of the SALK Institute.Technical Data
M.Wt:4758
Formula:C208H344N60O63S2
Sequence:SEEPPISLDLTFHLLREVLEMARAEQLAQQAHS
NRKLMEII
Storage:(Modifications: Ile-41 = C-terminal amide)
Desiccate at -20°C
CAS No:[86784-80-7]
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis and MSDS.
Certificate of Analysis / MSDS
Certificate of Analysis: View current batch
For specific/earlier batch please select:
Material Safety Data Sheet: View current batch
For specific/earlier batch please select:
References
Tache et al (1983) Inhibition of gastric acid secretion in rats by intracerebral injection of corticotropin-releasing factor. Science 222 935. Souza et al (1984) Corticotropin-releasing factor receptors in rat forebrain: autoradiographic identification. Science 224 1449. Rivier et al (1986) Mediation by corticotropin releasing factor (CRF) of adenohypophysial hormone secretion. Ann.Rev.Physiol. 48 475. Perrin and Vale (1999) Corticotropin releasing factor receptors and their ligand family. Ann.N.Y.Acad.Sci. 885 312.If you know of a useful citation for this product please let us know.
Keywords: CRF (human, rat), Stimulates, ACTH, release, Corticotropin-Releasing, Factor, Non-Selective, CRF, Receptors, agonists
Buy Now / Print Quote
Find multiple products by catalog number
RSS News Feed
Find out about new products as soon as they go live!
Click on the orange RSS button to read more about our RSS feed and actively opt in.






