CRF (human, rat)

Cat No. 1151

CRF (human, rat) Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2

Price and Availability

For CRF (human, rat) pricing & availability please select your country from the drop down menu:
Submit

Alternative Name: Corticotropin-ReleasingFactor (human, rat)

Biological Activity

Endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.

Licensing Information

Sold with the permission of the SALK Institute.

Technical Data

M.Wt:
4758
Formula:
C208H344N60O63S2
Sequence:
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHS NRKLMEII

(Modifications: Ile-41 = C-terminal amide)

Storage:
Desiccate at -20°C
CAS No:
[86784-80-7]

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis and MSDS.

Certificate of Analysis / MSDS

Certificate of Analysis: View current batch
For specific/earlier batch please select:  
Material Safety Data Sheet: View current batch
For specific/earlier batch please select:  

References

Tache et al (1983) Inhibition of gastric acid secretion in rats by intracerebral injection of corticotropin-releasing factor. Science 222 935. Souza et al (1984) Corticotropin-releasing factor receptors in rat forebrain: autoradiographic identification. Science 224 1449. Rivier et al (1986) Mediation by corticotropin releasing factor (CRF) of adenohypophysial hormone secretion. Ann.Rev.Physiol. 48 475. Perrin and Vale (1999) Corticotropin releasing factor receptors and their ligand family. Ann.N.Y.Acad.Sci. 885 312.

If you know of a useful citation for this product please let us know.

View Related Products by Target

Keywords: CRF (human, rat), Stimulates, ACTH, release, Corticotropin-Releasing, Factor, Non-Selective, CRF, Receptors, agonists

Buy Now / Print Quote

Find multiple products by catalog number


divider line

Print Quote Facility

Order via your purchasing department

Print Quote Facility

It's now even easier to place orders via your purchasing department.

Simply add a product to your cart & click on the "Print Quote" button.

more
divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Poster

'Gut Hormones and the Regulation of Appetite' summarizes the neuropeptide modulators and gut hormones that influence appetite

request
divider line

Endocrinology Guide

Endocrinology Product Guide

Highlights over 200 products for endocrinology research. Request a copy or view PDF today.

request
divider line

GPCRs and Signalling Networks

Written by M.J. Marinissen

GPCR Poster

'G-Protein-coupled Receptors and Signalling Networks' summarizes the intricate network of intracellular signalling pathways involved in GPCR function.

request
divider line

7-TM Receptor Signalling

Written by T. Kenakin et al

7-TM Poster

'Seven Transmembrane Receptor Signalling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy

request
divider line

Antidepressants - Current and Future Targets

Written by P. Skolnich et al

Parkinson's Poster

'Antidepressants - Current and Future Targets' provides an overview of the current and future targets for the treatment of major depressive disorder.

request
divider line

RSS News Feed

Find out about new products as soon as they go live!

Get the Tocris RSS feed

Click on the orange RSS button to read more about our RSS feed and actively opt in.

more