Exendin-4

Cat. No. 1933

Exendin-4 His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Price and Availability

For Exendin-4 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Names: Exenatide, AC 2993

Biological Activity

High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); originally isolated from Heloderma suspectum venom. Potently induces cAMP formation without stimulating amylase release in pancreatic acini. Potentiates glucose-induced insulin secretion in isolated rat islets. Protects against glutamate-induced neurotoxicity.

Technical Data

M.Wt:
4186.61
Formula:
C184H282N50O60S
Sequence:
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

(Modifications: Ser-39 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
141758-74-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Perry et al (2002) Protection and reversal of excitotoxic neuronal damage by glucagon-like peptide-1 and exendin-4. J.Pharmacol.Exp.Ther. 302 881. PMID: 12183643.

Goke et al (1993) Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting β-cells. J.Biol.Chem. 268 19650. PMID: 8396143.

Thorens et al (1993) Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor. Diabetes 42 1678. PMID: 8405712.

Eng et al (1992) Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. J.Biol.Chem. 267 7402. PMID: 1313797.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Exendin-4 include:

Pritchett and Hajnal (2012) Glucagon-like peptide-1 regulation of carbohydrate intake is differentially affected by obesogenic diets. Obesity (Silver Spring) 20 313. PMID: 22134200.

Do you know of a great paper that uses Exendin-4 from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Exendin-4, supplier, Potent, GLP-1, receptor, agonists, Receptors, Glucagon-Like, Peptide, 1, AC2993, Tocris Bioscience, Glucagon-Like Peptide 1 Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

New Products in this Area

[Pro3]-GIP (Rat)

High affinity rat GIP receptor partial agonist

[Pro3]-GIP (Mouse)

GIP receptor antagonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.