Glucagon-like peptide 1 (1-37) (human, rat)

Cat. No. 1851

Glucagon-like peptide 1 (1-37) (human, rat) His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Price and Availability

For Glucagon-like peptide 1 (1-37) (human, rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: GLP-1 (1-37) amide

Biological Activity

Pancreatic hormone synthesized by post-translational processing of proglucagon. Unlike truncated forms of GLP-1, it has no effect on food intake in rats and does not enhance pancreatic insulin secretion. However it induces insulin expression in intestinal epithelial cells, which can restore glucose homeostasis when implanted into diabetic mice.

Technical Data

M.Wt:
4169.52
Formula:
C186H275N51O59
Sequence:
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Solubility:
Soluble to 5 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
87805-34-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Suzuki et al (2003) Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into insulin-producing cells. Proc.Natl.Acad.Sci.USA 100 5034.

Navarro et al (1996) Colocalization of glucagon-like peptide-1 (GLP-1) receptors, glucose transporter GLUT-2, and glucokinase mRNAs in rat hypothalamic cells: evidence for a role of GLP-1 receptor agonists as an inhibitory signal for food and water intake. J.Neurochem. 67 1982. PMID: 8863504.

Bell et al (1983) Exon duplication and divergence in the human preproglucagon gene. Nature 304 368. PMID: 6877358.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Glucagon-like peptide 1 (1-37) (human, rat) include:

Zhang et al (2013) The slow afterhyperpolarization: a target of β1-adrenergic signaling in hippocampus-dependent memory retrieval. J Neurosci 33 5006. PMID: 23486971.

Do you know of a great paper that uses Glucagon-like peptide 1 (1-37) (human, rat) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Glucagon-like peptide 1 (1-37) (human, rat), supplier, Endogenous, pancreatic, peptide, GLP1, Receptors, Glucagon-Like, Peptide, 1, Glucagon-like, peptide1, (1-37), (human, rat), GLP1(1-37), amide, diabetes, Tocris Bioscience, Glucagon-Like Peptide 1 Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

New Products in this Area

[Pro3]-GIP (Rat)

High affinity rat GIP receptor partial agonist

[Pro3]-GIP (Mouse)

GIP receptor antagonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

IVBM 2016

IVBM 2016

October 30 - November 3, 2016

Boston, MA, USA

Booth: 2