Peptide YY (3-36)

Cat. No. 1618

Peptide YY (3-36) Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Price and Availability

For Peptide YY (3-36) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: PYY 3-36

Biological Activity

Y2 selective agonist. IC50 values are 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Inhibits food intake and reduces weight gain in vivo. Brain penetrant.

Technical Data

M.Wt:
3980.4
Formula:
C176H272N52O54
Sequence:
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY

(Modifications: Tyr-34 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
126339-09-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

Certificate of Analysis / Product Datasheet
Select another batch:

References are publications that support the products' biological activity.

Nonaka et al (2003) Characterization of blood-brain barrier permeability to PYY3-36 in the mouse. J.Pharmacol.Exp.Ther. 306 948. PMID: 12750431.

Batterham et al (2002) Gut hormone PYY3-36 physiologically inhibits food intake. Nature 418 650. PMID: 12167864.

Keire et al (2000) Primary structures of PYY, [Pro34]PYY and PYY-(3-36) confer different conformations and receptor selectivity. Am.J.Physiol.Gastrointest.Liver Physiol. 279 G126. PMID: 10898754.

If you know of a relevant reference for Peptide YY (3-36) please let us know.

Citations are publications that use Tocris products. Selected citations for Peptide YY (3-36) include:

Wu et al (2013) Peptide YY3-36 and 5-hydroxytryptamine mediate emesis induction by trichothecene deoxynivalenol (vomitoxin). Toxicol Sci 133 186. PMID: 23457120.

Do you know of a great paper that uses Peptide YY (3-36) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Peptide YY (3-36), supplier, Selective, Y2, receptor, agonists, Neuropeptide, Y, Receptors, NPY, PeptideYY, (3-36), PYY336, neuropeptides, Tocris Bioscience, NPY Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

Cardiovascular Life Science Poster

Our Cardiovascular poster highlights the key G protein-coupled receptors involved in the regulation of vascular reactivity. Request copy or view PDF today.

divider line

New Products in this Area

Retrobradykinin

Reverse analog of Bradykinin

TASP 0390325

Potent and selective V1B receptor antagonist; orally bioavailable

ML 233

Non-peptide apelin receptor agonist

BML 111

FPR2 (lipoxin A4 receptor) agonist

Amylin (rat)

Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors

Calcitonin (human)

Endogenous calcitonin receptor agonist; inhibits bone resorption

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.