SNX 482

Cat. No. 2945

SNX 482 Gly-Val-Asp-Lys-Ala-Gly-Cys-Arg-Tyr-Met-Phe-Gly-Gly-Cys-Ser-Val-Asn-Asp-Asp-Cys-Cys-Pro-Arg-Leu-Gly-Cys-His-Ser-Leu-Phe-Ser-Tyr-Cys-Ala-Trp-Asp-Leu-Thr-Phe-Ser-Asp

Price and Availability

For SNX 482 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent and selective, voltage-dependent R-type CaV2.3 calcium channel blocker (IC50 = 30 nM). Antinociceptive; inhibits nociceptive C-fibre and Aδ-fibre-evoked neuronal responses.

Technical Data

M.Wt:
4495.01
Formula:
C192H274N52O60S7
Sequence:
GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

(Modifications: Disulfide bridge between 7 - 21, 14 - 26, 20 - 33)

Solubility:
Soluble in water
Storage:
Desiccate at -20°C
CAS No:
203460-30-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Matthews et al (2007) The CaV2.3 calcium channel antagonist SNX-482 reduces dorsal horn neuronal responses in a rat model of chronic neuropathic pain. Eur.J.Neurosci. 25 3561. PMID: 17610575.

Bourinet et al (2001) Interaction of SNX482 with domains III and IV inhibits activation gating of α1E (CaV2.3) calcium channels. Biophys.J. 81 79. PMID: 11423396.

Newcomb et al (1998) Selective peptide antagonist of the class E calcium channel from the venom of the Tarantula Hysterocrates gigas. Biochemistry 37 15353. PMID: 9799496.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for SNX 482 include:

Higley and Sabatini (2010) Competitive regulation of synaptic Ca2+ influx by D2 dopamine and A2A adenosine receptors. Nat Neurosci 13 958. PMID: 20601948.

Do you know of a great paper that uses SNX 482 from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: SNX 482, supplier, Potent, selective, CaV23, blockers, R-type, Calcium, CaV, Channels, R-Type, voltage-gated, voltage-dependent, Ca2+, SNX482, Tocris Bioscience, Voltage-gated Calcium Channel (CaV) Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Antidepressants - Current and Future Targets

Written by P. Skolnich et al

Depression Life Science Poster

Our Depression poster highlights presynaptic and postsynaptic targets for the potential treatment of major depressive disorder. Request copy or view PDF today.

divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.