ω-Agatoxin TK

Cat. No. 2802

w-Agatoxin TK Glu-Asp-Asn-Cys-Ile-Ala-Glu-Asp-Tyr-Gly-Lys-Cys-Thr-Trp-Gly-Gly-Thr-Lys-Cys-Cys-Arg-Gly-Arg-Pro-Cys-Arg-Cys-Ser-Met-Ile-Gly-Thr-Asn-Cys-Glu-Cys-Thr-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Ser-Phe-Ala (Disulfide bridge: C4-C20,C12-C25,C19-C36,C27-34)

Price and Availability

For ω-Agatoxin TK pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: Agatoxin IVB

Biological Activity

Selective blocker of CaV2.1 P/Q-type calcium channels.

Technical Data

M.Wt:
5273.02
Formula:
C215H337N65O70S10
Sequence:
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA

(Modifications: Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34)

Solubility:
Soluble in water
Storage:
Desiccate at -20°C
CAS No:
158484-42-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Barral et al (2001) High-affinity inhibition of glutamate release from corticostriatal synapses by ω-agatoxin TK. Eur.J.Pharmacol. 430 167. PMID: 11711028.

Teramoto et al (1997) A novel type of calcium channel sensitive to ω-agatoxin-TK in cultured rat cerebral cortical neurons. Brain Res. 756 225. PMID: 9187336.

Teramoto et al (1993) A novel peptide from funnel web spider venom, ω-Aga-TK, selectively blocks P-type calcium channels. Biochem.Biophys.Res.Comms. 196 134.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for ω-Agatoxin TK include:

Cramer et al (2015) Abnormal excitability and episodic low-frequency oscillations in the cerebral cortex of the tottering mouse. Neuropsychopharmacology 35 5664. PMID: 25855180.

Fakira et al (2012) Purkinje cell dysfunction and delayed death in plasma membrane calcium ATPase 2-heterozygous mice. J Neurosci 51 22. PMID: 22789621.

Grubb and Burrone (2010) Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability. Mol Cell Neurosci 465 1070. PMID: 20543823.

Maier et al (2010) Sustained glutamate receptor activation down-regulates GABAB receptors by shifting the balance from recycling to lysosomal degradation. J Biol Chem 285 35606. PMID: 20826795.

Do you know of a great paper that uses ω-Agatoxin TK from Tocris? If so please let us know.show all ▼show less ▲

View Related Products by Target

View Related Products by Product Action

Keywords: w-Agatoxin TK, supplier, Ca2+, channel, blockers, P/Q-type, Calcium, CaV, Channels, P-Type, voltage-gated, voltage-dependent, Omega-Agatoxin, ω-Agatoxin, TK, w-AgatoxinTK, AgatoxinIVB, Tocris Bioscience, Voltage-gated Calcium Channel (CaV) Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Antidepressants - Current and Future Targets

Written by P. Skolnich et al

Depression Life Science Poster

Our Depression poster highlights presynaptic and postsynaptic targets for the potential treatment of major depressive disorder. Request copy or view PDF today.

divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.