Bay 55-9837

Cat. No. 2711

BAY 55-9837 His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2

Price and Availability

For Bay 55-9837 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Selective VPAC2 receptor agonist (EC50 values are 0.4, 100 and >1000 nM for VPAC2, VPAC1 and PAC1, respectively in a cAMP accumulation assay; IC50 values are 60, 8700 and >10000 nM for VPAC2, VPAC1 and PAC1, respectively in a competition binding assay). Stimulates glucose-dependent insulin secretion in isolated human pancreatic islets. Reduces HIV-1 viral replication and shows cooperative effects when given in conjunction with VPAC1 agonists.

Technical Data

M.Wt:
3742.29
Formula:
C167H270N52O46
Sequence:
HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY

(Modifications: Tyr-31 = C-terminal amide)

Solubility:
Soluble to 2 mg/ml in water
Storage:
Store at -20°C
CAS No:
463930-25-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

Certificate of Analysis / Product Datasheet
Select another batch:

References are publications that support the products' biological activity.

Temerozo et al (2013) Macrophage resistance to HIV-1 infection is enhanced by the neuropeptides VIP and PACAP. PLoS ONE 8 (6) 67701. PMID: 23818986.

Pan et al (2007) Engineering novel VPAC2-selective agonists with improved stability and glucose-lowering activity in vivo. J.Pharmacol.Exp.Ther. 320 900. PMID: 17110523.

Clairmont et al (2006) Engineering of a VPAC2 receptor peptide agonist to impart dipeptidyl peptidase IV stability and enhance in vivo glucose disposal. J.Med.Chem. 49 7545. PMID: 17149884.

Tsutsumi et al (2002) A potent and highly selective VPAC2 agonist enhances glucose-induced insulin release and glucose disposal: a potential therapy for type 2 diabetes. Diabetes 51 1453. PMID: 11978642.

If you know of a relevant reference for Bay 55-9837 please let us know.

Citations are publications that use Tocris products. Selected citations for Bay 55-9837 include:

Valeria et al (2016) A subnanomolar concentration of Pituitary Adenylate Cyclase Activating Polypeptide (PACAP) pre-synaptically modulates glutamatergic transmission in the rat hippocampus acting through acetylcholine Neuroscience 340 551. PMID: 27816700.

Toda and Huganir (2015) Regulation of AMPA receptor phosphorylation by the neuropeptide PACAP38. Purinergic Signal 112 6712. PMID: 25964356.

Pantazopoulos et al (2010) Chronic stimulation of the hypothalamic vasoactive intestinal peptide receptor lengthens circadian period in mice and hamsters. Am J Physiol Regul Integr Comp Physiol 299 R379. PMID: 20463182.

Do you know of a great paper that uses Bay 55-9837 from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: BAY 55-9837, supplier, Potent, selective, VPAC2, agonists, Vasoactive, Intestinal, Peptide, Receptors, VPAC, VIP, BAY55-9837, Tocris Bioscience, VIP Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Asthma Life Science Poster

Written by Peter J. Barnes

Asthma Life Science Poster

Our Asthma poster highlights key pathways and new therapies used to treat asthma, including those currently in clinical development. Request copy today.

divider line

New Products in this Area

ELA-14 negative control

Negative control for ELA-14 (Cat.No.6293).

ELA-14 (human)

Potent apelin (APJ) receptor agonist

Retrobradykinin

Reverse analog of Bradykinin

TASP 0390325

Potent and selective V1B receptor antagonist; orally bioavailable

ML 233

Non-peptide apelin receptor agonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.