Calcitonin (human)

Cat. No. 6031new

Calcitonin (human) Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2

Price and Availability

For Calcitonin (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption.

Technical Data

M.Wt:
3417.87
Formula:
C151H226N40O45S3
Sequence:
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP

(Modifications: Pro-32 = C-terminal amide, Disulfide bridge between 1 - 7)

Solubility:
Soluble to 2 mg/ml in water
Storage:
Store at -20°C
CAS No:
21215-62-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

Bower and Hay (2016) Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br.J.Pharmacol. 173 1883. PMID: 27061187.

Lee et al (2016) Calcitonin and amylin receptor peptide interaction mechanisms. J.Biol.Chem. 291 16416. PMID: 27474777.

Foster (1968) Calcitonin. A review of experimental and clinical investigations. Postgrad.Med.J. 44 411. PMID: 4871775.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Calcitonin (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Calcitonin (human), supplier, endogenous, calcitonin, receptors, agonists, agonism, inhibits, bone, resorption, Tocris Bioscience, Calcitonin and Related Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

New Products in this Area

ML 233

Non-peptide apelin receptor agonist

BML 111

FPR2 (lipoxin A4 receptor) agonist

Amylin (rat)

Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors

Spexin

Potent GAL2/3 agonist; exhibits anxiolytic effects in vivo

MM 54

Potent apelin receptor antagonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.