Amylin (rat)

Cat. No. 6030

Amylin (rat) Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

Price and Availability

For Amylin (rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors (pEC50 values are 7.06-9.50 at hCTa, 8.11 at rCTa, 7.73-10.1 at hAMY1a, 9.74 at rAMY1a, 7.92 at hAMY1b, 7.78-9.9 at hAMY2a, 7.94 at hAMY2b, 8.09-10.8 at hAMY3a, 9.97 at rAMY and 8.19 at hAMY3b) receptors. Suppresses insulin-stimulated glucose uptake. Delays gastric emptying and promotes satiety. Active in vivo.

Technical Data

M.Wt:
3920.43
Formula:
C167H272N52O53S2
Sequence:
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

(Modifications: Tyr-37 = C-terminal amide, Disulfide bridge between 2 - 7)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
124447-81-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

References are publications that support the products' biological activity.

Bower et al (2016) Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br.J.Pharmacol. 173 1883. PMID: 27061187.

If you know of a relevant reference for Amylin (rat) please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Amylin (rat) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Amylin (rat), supplier, Potent, endogenous, peptide, agonist, amylin, calcitonin, CGRP, adrenomedullin, receptors, obesity, diabetes, satiety, Tocris Bioscience, Calcitonin and Related Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation Scientific Review

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

New Products in this Area

ELA-14 negative control

Negative control for ELA-14 (Cat.No.6293).

ELA-14 (human)

Potent apelin (APJ) receptor agonist

Retrobradykinin

Reverse analog of Bradykinin

TASP 0390325

Potent and selective V1B receptor antagonist; orally bioavailable

ML 233

Non-peptide apelin receptor agonist

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.