[Pro3]-GIP (Rat)

Cat. No. 5837

[Pro3]-GIP (Rat) Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln

Price and Availability

For [Pro3]-GIP (Rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

High affinity rat GIP receptor partial agonist (Kd = 13 nM). Increases cAMP accumulation in COS-7 cells transfected with rat GIP receptor, while also acting as a competitive antagonist of GIP.

Technical Data

M.Wt:
4970.63
Formula:
C226H343N61O64S
Sequence:
YAPGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Solubility:
Soluble to 2 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

References are publications that support the products' biological activity.

Sparre-Ulrich et al (2016) Species-specific action of (Pro3)GIP - a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors. Br.J.Pharmacol. 173 27. PMID: 26359804.

If you know of a relevant reference for [Pro3]-GIP (Rat) please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses [Pro3]-GIP (Rat) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: [Pro3]-GIP (Rat), supplier, GIP, receptors, antagonists, antagonism, glucose-dependent, insulinotropic, polypeptide, partial, agonist, agonism, insulin, Tocris Bioscience, GIP Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation Scientific Review

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Bio-Techne Events

SENC 2017

17th National Congress of the Spanish Society of Neuroscience

September 27 - 30, 2017

Alicante, Spain