Guangxitoxin 1E

Cat. No. 5676

Guangxitoxin 1E Glu-Gly-Glu-Cys-Gly-Gly-Phe-Trp-Trp-Lys-Cys-Gly-Ser-Gly-Lys-Pro-Ala-Cys-Cys-Pro-Lys-Tyr-Val-Cys-Ser-Pro-Lys-Trp-Gly-Leu-Cys-Asn-Phe-Pro-Met-Pro

Price and Availability

For Guangxitoxin 1E pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Kv2.1 and Kv2.2 channel blocker (IC50 values are 1-3 nM). Enhances glucose-stimulated insulin secretion from human islets in vitro, but not from islet cells lacking the Kv2.1 channel. Has no significant effect on plasma insulin, glucagon or blood glucose levels in mice, but increases plasma somatostatin levels.

Technical Data

M.Wt:
3948.61
Formula:
C178H248N44O45S7
Sequence:
EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP

(Modifications: Disulfide bridge: 4-19,11-24,18-31)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
1233152-82-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

References are publications that support the products' biological activity.

Li et al (2013) The role of voltage-gated potassium channels Kv2.1 and Kv2.2 in the regulation of insulin and somatostatin release from pancreatic islets. J.Pharmacol.Exp.Ther. 344 407. PMID: 23161216.

Herrington (2007) Gating modifier peptides as probes of pancreatic beta-cell physiology. Toxicon 49 231. PMID: 17101164.

If you know of a relevant reference for Guangxitoxin 1E please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Guangxitoxin 1E from Tocris? If so please let us know.

View Related Products by Product Action

Keywords: Guangxitoxin 1E, supplier, Kv2.1, Kv2.2, inward, rectifier, potassium, current, pancreatic, islets, beta, cells, inhibits, inhibitors, insulin, glucose, somatostatin, GxTx-1E, venoms, Tocris Bioscience, Voltage-gated Potassium (KV) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Pain Life Science Poster

Written by Grant D. Nicol and Michael R. Vasko

Pain Life Science Poster

Our Peripheral Sensitization poster gives a summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request copy or view PDF today.

divider line

New Products in this Area

Retigabine

KV7 channel activator

AMP PNP

Kir6 blocker; non-hydrolyzable AMP analog

Sign-up for new product e-alerts
divider line

Bio-Techne Events

26th ISN-ESN Biennal Meeting

26th ISN-ESN Biennial Meeting

August 20 - 24, 2017

Paris , France

Booth: 11