GLP-1 (7-37)

Cat. No. 5374

GLP-1 (7-37) His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Price and Availability

For GLP-1 (7-37) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous GLP-1 receptor ligand; bioactive and truncated form of GLP-1; insulinotropic hormone.

Technical Data

M.Wt:
3355.71
Formula:
C151H228N40O47
Sequence:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
106612-94-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Marchetti et al (2012) A local glucagon-like peptide 1 (GLP-1) system in human pancreatic islets. Diabetologia 55 3262. PMID: 22965295.

Ban et al (2010) Glucagon-like peptide (GLP)-1(9-36)amide-mediated cytoprotection is blocked by exendin(9-39) yet does not require the known GLP-1 receptor. Endocrinology 151 1520. PMID: 20172966.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses GLP-1 (7-37) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: GLP-1 (7-37), supplier, Endogenous, GLP-1, receptor, ligands, bioactive, truncated, form, Glucagon, like, peptide, receptor, insulinotropic, proglucagon, agonists, Tocris Bioscience, Glucagon-Like Peptide 1 Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

New Products in this Area

[Pro3]-GIP (Rat)

High affinity rat GIP receptor partial agonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

ASCB 2016

ASCB 2016

December 3 - 7, 2016

San Francisco, CA,

Booth: 314