Huwentoxin XVI

Cat. No. 5235

Huwentoxin XVI Cys-Ile-Gly-Glu-Gly-Val-Pro-Cys-Asp-Glu-Asn-Asp-Pro-Arg-Cys-Cys-Ser-Gly-Leu-Val-Cys-Leu-Lys-Pro-Thr-Leu-His-Gly-Ile-Trp-Tyr-Lys-Ser-Tyr-Tyr-Cys-Tyr-Lys-Lys

Price and Availability

For Huwentoxin XVI pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent and selective N-type Ca2+ channel blocker (IC50 ~ 60 nM); selectively and reversibly blocks N-type Ca2+ channels. Does not block T-type Ca2+ channels, K+ channels or Na+ channels. Exhibits analgesic effects in vivo.

Technical Data

M.Wt:
4437.13
Formula:
C196H292N50O56S6
Sequence:
CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK

(Modifications: Disulfide bridge: 1-16,8-21,15-36)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
1600543-88-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Deng et al (2014) Huwentoxin-XVI, an analgesic, highly reversible mammalian N-type calcium channel antagonist from Chinese tarantula Ornithoctonus huwena. Neuropharmacology 79 657. PMID: 24467846.

Jiang et al (2010) Venomics of the spider Ornithoctonus huwena based on transcriptomic versus proteomic analysis. Comp.Biochem.Physiol.Part D Genomics Proteomics 5 81. PMID: 20403776.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Huwentoxin XVI from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Huwentoxin XVI, supplier, Huwentoxin, 16, Potent, selective, N, type, Ca2+, channel, blockers, reversibly, analgesics, Tocris Bioscience, Voltage-gated Calcium Channel (CaV) Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Antidepressants - Current and Future Targets

Written by P. Skolnich et al

Depression Life Science Poster

Our Depression poster highlights presynaptic and postsynaptic targets for the potential treatment of major depressive disorder. Request copy or view PDF today.

divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.