LL 37

Cat. No. 5213

LL 37 Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Price and Availability

For LL 37 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable.

Technical Data

M.Wt:
4493.32
Formula:
C205H340N60O53
Sequence:
[LL-37, 37 aa]
Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
154947-66-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

Certificate of Analysis / Product Datasheet
Select another batch:

References are publications that support the products' biological activity.

Steinstraesser et al (2014) Skin electroporation of a plasmid encoding hCAP-18/LL-37 host defense peptide promotes wound healing. Mol.Ther. 22 734. PMID: 24394186.

Ren et al (2012) Host immune defense peptide LL-37 activates caspase-independent apoptosis and suppresses colon cancer. Cancer Res. 72 6512. PMID: 23100468.

Seil et al (2010) Spotlight on human LL-37, an immunomodulatory peptide with promising cell-penetrating properties. Pharmaceuticals 3 3435.

Yang et al (2000) LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J.Exp.Med. 192 1069. PMID: 11015447.

If you know of a relevant reference for LL 37 please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses LL 37 from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: LL 37, supplier, LL37, antimicrobial, derivative, cathelicidin, chemotaxis, chemotactic, wound, healing, anticancer, cell, permeable, Tocris Bioscience, Miscellaneous Compound products

Quick Order

Find multiple products by catalog number

divider line

New Product Guide

Spring/Summer 2017

New Product Guide (Spring/Summer 2017)

Our New Product guide highlights over 130 new products added in the first half of 2017. View PDF today.

divider line

New Products in this Area

Nanchangmycin

Antiviral; active against Zika, West Nile and dengue viruses

25-Hydroxycholesterol

Antiviral; also α-crystallin (cryAB) chaperone

Filipin III

Polyene antibiotic; inhibits formation of pathological isoform of prion protein

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.