Agitoxin 2

Cat. No. 5195

Agitoxin 2 Gly-Val-Pro-Ile-Asn-Val-Ser-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys

Price and Availability

For Agitoxin 2 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent Shaker K+ channel blocker (Ki = 0.64 nM). Also inhibits Kv1.3, Kv1.6 and Kv1.1 K+ channels (Ki values are 4, 37 and 44 pM respectively).

Technical Data

M.Wt:
4090.87
Formula:
C169H278N54O48S8
Sequence:
GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK

(Modifications: Disulfide bridge: 8-28,14-33,18-35)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
168147-41-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Anangi et al (2012) Recombinant expression of margatoxin and agitoxin-2 in Pichia pastoris: an efficient method for production of KV1.3 channel blockers. PLoS ONE 7 e52965. PMID: 23300835.

Gross et al (1996) Agitoxin footprinting the shaker potassium channel pore. Neuron 16 399. PMID: 8789954 .

Garcia et al (1994) Purification and characterization of three inhibitors of voltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom. Biochemistry 33 6834. PMID: 8204618.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Agitoxin 2 from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Agitoxin 2, supplier, potent, shaker, potassium, K+, channels, blockers, inhibits, inhibitors, Kv1.4, kv1.1, kv1.3, kv1.6, voltage, gated, Tocris Bioscience, Voltage-gated Potassium (KV) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Peripheral Sensitization

Written by Grant D. Nicol and Michael R. Vasko

Pain Life Science Poster

Our Peripheral Sensitization poster gives a summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request copy or view PDF today.

divider line

New Products in this Area

BeKm 1

Potent and selective KV11.1 (hERG) channel blocker

Sign-up for new product e-alerts
divider line

Bio-Techne Events

One Day Symposium

Bio-Techne Symposium 2017

Epigenetic Regulation of Stem Cell Differentiation

March 1, 2017

Amsterdam, The Netherlands