BDS I

Cat. No. 5184

BDS I Ala-Ala-Pro-Cys-Phe-Cys-Ser-Gly-Lys-Pro-Gly-Arg-Gly-Asp-Leu-Trp-Ile-Leu-Arg-Gly-Thr-Cys-Pro-Gly-Gly-Tyr-Gly-Tyr-Thr-Ser-Asn-Cys-Tyr-Lys-Trp-Pro-Asn-Ile-Cys-Cys-Tyr-Pro-His

Price and Availability

For BDS I pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: Blood depressing substance 1

Biological Activity

Potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels. Enhances TTX-sensitive sodium currents in rat small dorsal root ganglion neurons. Neuroprotective.

Technical Data

M.Wt:
4708.37
Formula:
C210H297N57O56S6
Sequence:
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH

(Modifications: Disulfide bridge: 4-39,6-32,22-40)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

References are publications that support the products' biological activity.

Liu et al (2012) Modulation of neuronal sodium channels by the sea anemone peptide BDS-I. J.Neurophysiol. 107 3155. PMID: 22442564.

Pannaccione et al (2007) Up-regulation and increased activity of KV3.4 channels and their accessory subunit MinK-related peptide 2 induced by amyloid peptide are involved in apoptotic neuronal death. Mol.Pharmacol. 72 665. PMID: 17495071.

Diochot et al (1998) Sea anemone peptides with a specific blocking activity against the fast inactivating potassium channel Kv3.4. J.Biol.Chem. 273 6744. PMID: 9506974.

If you know of a relevant reference for BDS I please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses BDS I from Tocris? If so please let us know.

View Related Products by Product Action

Keywords: BDS I, supplier, BDSI, blood, depressing, substance, 1, potent, reversible, Kv3.4, potassium, channels, blockers, attenuated, inactivation, sodium, currents, Nav1.7, and, Nav1.3, neuroprotective, venoms, Tocris Bioscience, Voltage-gated Potassium (KV) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Peripheral Sensitization

Written by Grant D. Nicol and Michael R. Vasko

Pain Life Science Poster

Our Peripheral Sensitization poster gives a summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request copy or view PDF today.

divider line

New Products in this Area

Retigabine

KV7 channel activator

AMP PNP

Kir6 blocker; non-hydrolyzable AMP analog

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.