
Cat. No. 5031

Pramlintide KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY(Modifications: Disulfide bridge: 2-7)(Modifications: Tyr-37 = C-terminal amide)

Price and Availability

For Pramlintide pricing & availability please select your country from the drop down menu:
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Synthetic version of amylin (Cat. No. 3418). Exhibits high affinity for amylin, CGRP and calcitonin receptors (Ki values are 0.023, 3.8 and 5.1 nM respectively). Reduces postprandial hyperglycemia; also inhibits gastric emptying.

Technical Data

Soluble to 1 mg/ml in water
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

Hoogwerf et al (2008) Pramlintide, the synthetic analogue of amylin: phsyiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk. Vasc.Health Risk Manag. 4 355. PMID: 18561511.

Young et al (1996) Preclinical pharmacology of pramlintide in the rat: comparisons with human and rat amylin. Drug Dev.Res. 37 231.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Pramlintide from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Pramlintide, supplier, Pramlintide, antidiabetic, amylin, synthetic, calcitonin, CGRP, receptors, Tocris Bioscience, Calcitonin and Related Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

New Products in this Area

ML 233

Non-peptide apelin receptor agonist

BML 111

FPR2 (lipoxin A4 receptor) agonist

Amylin (rat)

Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors

Calcitonin (human)

Endogenous calcitonin receptor agonist; inhibits bone resorption


Potent GAL2/3 agonist; exhibits anxiolytic effects in vivo

MM 54

Potent apelin receptor antagonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

Experimental Biology 2017

Experimental Biology 2017

April 22 - 26, 2017

Chicago, IL, USA

Booth: 1341