Phrixotoxin 3

Cat. No. 4914

Phrixotoxin 3 Asp-Cys-Leu-Gly-Phe-Leu-Trp-Lys-Cys-Asn-Pro-Ser-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Gln-Ile

Price and Availability

For Phrixotoxin 3 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent blocker of voltage-gated sodium channels (IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Blocks inward sodium currents in a voltage-dependent manner.

Technical Data

M.Wt:
4059.74
Formula:
C176H269N51O48S6
Sequence:
DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI

(Modifications: Disulfide bridges: 2-17,9-23,16-30)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
880886-00-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Ono et al (2011) Characterization of voltage-dependent calcium channel blocking peptides from the venom of the tarantula Grammostola rosea. Toxicon. 58 265. PMID: 21740921.

Bosmans et al (2006) Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Mol.Pharmacol. 69 419. PMID: 16267209.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Phrixotoxin 3 from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Phrixotoxin 3, supplier, modulators, modulates, sodium, voltage-gated, channels, NaV1.2, NaV1.3, NaV1.5, Tocris Bioscience, Voltage-gated Sodium (NaV) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Cancer Research Product Guide

Cancer Research Product Guide

Our Cancer Research Guide highlights over 750 products for cancer research. Request copy or view PDF today.

divider line

New Products in this Area

PF 05089771

Potent and selective Nav1.7 channel blocker

OD1

Potent hNav1.4, rNav1.6 and rNav1.7 channel activator

Mambalgin 1

Selective ASIC1a inhibitor; analgesic

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.