ProTx I

Cat. No. 4665

ProTx I Glu-Cys-Arg-Tyr-Trp-Leu-Gly-Gly-Cys-Ser-Ala-Gly-Gln-Thr-Cys-Cys-Lys-His-Leu-Val-Cys-Ser-Arg-Arg-His-Gly-Trp-Cys-Val-Trp-Asp-Gly-Thr-Phe-Ser

Price and Availability

For ProTx I pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Selective CaV3.1 channel blocker (IC50 values are 0.2 and 31.8 μM for hCaV3.1 and hCaV3.2 respectively). Also reversibly inhibits NaV1.8 and blocks KV2.1 channels.

Technical Data

M.Wt:
3987.51
Formula:
C171H245N53O47S6
Sequence:
ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS

(Modifications: Disulfide bridge: 2-16, 9-21, 15-28)

Solubility:
Soluble to 2 mg/ml in water
Storage:
Store at -20°C
CAS No:
484598-35-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Ohkubo and Yamazaki (2012) T-type voltage-activated calcium channel Cav3.1, but not Cav3.2, is involved in the inhibition of proliferation and apoptosis in MCF-7 human breast cancer cells. Int.J.Oncol. 41 267. PMID: 22469755.

Ohkubo et al (2010) Tarantula toxin ProTx-I differentiates between human T-type voltage-gated Ca2+ channels Cav3.1 and Cav3.2. J.Pharmacol.Sci. 112 452. PMID: 20351484.

Middleton et al (2002) Two tarantula peptides inhibit activation of multiple sodium channels. Biochemistry 41 14734. PMID: 12475222.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses ProTx I from Tocris? If so please let us know.

View Related Products by Product Action

Keywords: ProTx I, supplier, ProTxI, calcium, sodium, potassium, ion, channels, NaV1.8, CaV3.1, CaV3.2, KV2.1, selective, blockers, Tocris Bioscience, Voltage-gated Calcium Channel (CaV) Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Antidepressants - Current and Future Targets

Written by P. Skolnich et al

Depression Life Science Poster

Our Depression poster highlights presynaptic and postsynaptic targets for the potential treatment of major depressive disorder. Request copy or view PDF today.

divider line

Bio-Techne Events

One Day Symposium

Bio-Techne Symposium 2017

Epigenetic Regulation of Stem Cell Differentiation

March 1, 2017

Amsterdam, The Netherlands