Obtustatin

Cat. No. 4664

Obtustatin Cys-Thr-Thr-Gly-Pro-Cys-Cys-Arg-Gln-Cys-Lys-Leu-Lys-Pro-Ala-Gly-Thr-Thr-Cys-Trp-Lys-Thr-Ser-Leu-Thr-Ser-His-Tyr-Cys-Thr-Gly-Lys-Ser-Cys-Asp-Cys-Pro-Leu-Tyr-Pro-Gly

Price and Availability

For Obtustatin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen). Selective for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7. Inhibits FGF2-stimulated angiogenesis in the chicken chorioallantoic model. Displays antitumor efficacy in a synergistic mouse model of Lewis lung carcinoma; blocks human melanoma growth in nude mice.

Technical Data

M.Wt:
4393.07
Formula:
C184H284N52O57S8
Sequence:
CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG

(Modifications: Disulfide bridge: 1 - 10, 6 - 29, 7 - 34, 19 - 36)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Brown et al (2008) Angiostatic activity of obtustatin as α1β1 integrin inhibitor in experimental melanoma growth. Int.J.Cancer 123 2195. PMID: 18712720.

Marcinkiewicz et al (2003) Obtustatin: a potent and selective inhibitor of α1β1 integrin in vitro and angiogenesis in vivo. Cancer Res. 63 2020. PMID: 12727812.

Moreno-Murciano et al (2003) Amino acid sequence and homology modeling of obtustatin, a novel non-RGD-containing short disintegrin isolated from the venom of Vipera lebetina obtusa. Protein Sci. 12 366. PMID: 12538900.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Obtustatin from Tocris? If so please let us know.

View Related Products by Product Action

Keywords: Obtustatin, supplier, integrins, alpha1beta1, a1b1, aαnβ, potent, selective, inhibitors, inhibits, antiangiogenics, angiogenesis, Tocris Bioscience, Integrin Receptor Inhibitor products

Quick Order

Find multiple products by catalog number

divider line

Immunology Guide

Immunology Product Listing

Our Immunology listing highlights over 190 products for immunology research. Request copy or view PDF today.

divider line

New Products in this Area

ATN 161

α5β1 integrin receptor antagonist

FSL 1

TLR2/6 agonist (also a putative TLR10 ligand)

Cilengitide

Potent and selective inhibitor of integrins αvβ3 and αvβ5

SM 324405

Potent TLR7 agonist

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.