ProTx II

Cat. No. 4023

ProTx II Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Leu-Trp

Price and Availability

For ProTx II pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Selective NaV1.7 channel blocker. Shifts activation gating positively and decreases current magnitude. Displays 100-fold selectivity over other sodium channel subtypes.

Technical Data

M.Wt:
3826.59
Formula:
C168H250N46O41S8
Sequence:
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

(Modifications: Disulfide bridge: 2-16, 9-21, 15-25)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
484598-36-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

Certificate of Analysis / Product Datasheet
Select another batch:

Edgerton et al (2008) Evidence for multiple effects of ProTxII on activation gating in NaV 1.5. Toxicon. 52 489. PMID: 18657562.

Schmalhofer et al (2008) ProTx-II, a selective inhibitor of NaV 1.7 sodium channels, blocks action potential propagation in nociceptors. Mol.Pharmacol. 74 1476. PMID: 18728100.

Smith et al (2007) Molecular interactions of the gating modifier toxin ProTx-II with NaV 1.5: implied existence of a novel toxin binding site coupled to activation. J.Biol.Chem. 282 12687. PMID: 17339321.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses ProTx II from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: ProTx II, supplier, toxins, voltage, gated, sodium, Na+, channels, NaV1.7, potent, selective, blockers, venoms, Tocris Bioscience, Voltage-gated Sodium (NaV) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Cancer Research Product Guide

Cancer Research Product Guide

Our Cancer Research Guide highlights over 750 products for cancer research. Request copy or view PDF today.

divider line

New Products in this Area

4,9-Anhydrotetrodotoxin

Potent and selective Nav1.6 channel blocker

Sign-up for new product e-alerts
divider line

Bio-Techne Events

BNA festival

BNA 2017 Festival of Neuroscience

April 10 - 13, 2017

Birmingham, UK

Booth: 40