Kaliotoxin

Cat. No. 3564

Kaliotoxin Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Ser-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys
(Disulfide bridges: 8 - 28, 14 - 33, 18 - 35)

Price and Availability

For Kaliotoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1 and 25 nM for KV1.3, KV1.1 and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.

Technical Data

M.Wt:
4149.94
Formula:
C171H283N55O49S8
Sequence:
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK

(Modifications: Disulfide bridge between 8 - 28, 14 - 33, 18 - 35)

Solubility:
Soluble to 2 mg/ml in water
Storage:
Store at -20°C
CAS No:
145199-73-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Korukottu et al (2008) High-resolution 3D structure determination of kaliotoxin by solid-state NMR spectroscopy. PLoS ONE 3 e2359. PMID: 18523586.

Mourre et al (1999) Distribution in rat brain of binding sites of kaliotoxin, a blocker of Kv1.1and Kv1.3 α-subunits. J.Pharmacol.Exp.Ther. 291 943. PMID: 10565809.

Romi et al (1993) Synthesis and characterization of kaliotoxin: is the 26-32 sequence essential for potassium channel recognition? J.Biol.Chem. 268 26302. PMID: 8253752.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Kaliotoxin from Tocris? If so please let us know.

View Related Products by Product Action

Keywords: Kaliotoxin, supplier, potassium, channels, blockers, ca2+-activated, voltage, sensitive, gated, K+, Tocris Bioscience, Voltage-gated Potassium (KV) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Peripheral Sensitization

Written by Grant D. Nicol and Michael R. Vasko

Pain Life Science Poster

Our Peripheral Sensitization poster gives a summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request copy or view PDF today.

divider line

New Products in this Area

BeKm 1

Potent and selective KV11.1 (hERG) channel blocker

Sign-up for new product e-alerts
divider line

Bio-Techne Events

ASCB 2016

ASCB 2016

December 3 - 7, 2016

San Francisco, CA,

Booth: 314