Margatoxin

Cat. No. 3563

Margatoxin Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His     (Disulfide bridges: 7 - 29, 13 - 34, 17 - 36)

Price and Availability

For Margatoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: MgTX

Biological Activity

Potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Technical Data

M.Wt:
4178.96
Formula:
C178H286N52O50S7
Sequence:
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

(Modifications: Disulfide bridge between 7 - 29, 13 - 34, 17 - 36)

Solubility:
Soluble to 0.50 mg/ml in water
Storage:
Store at -20°C
CAS No:
145808-47-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Certificate of Analysis / Product Datasheet
Select another batch:

Erdogan et al (2005) Margatoxin inhibits VEGF-induced hyperpolarization, proliferation and nitric oxide production of human endothelial cells. J.Vasc.Res. 42 368. PMID: 16043967.

Garcia-Calvo et al (1993) Purification, characterization, and biosynthesis of Margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J.Biol.Chem. 268 18866. PMID: 8360176.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Margatoxin from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Margatoxin, supplier, Kv1.3, channel, blocker, voltage-gated, potassium, channels, MgTX, MTX, Tocris Bioscience, Voltage-gated Potassium (KV) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Peripheral Sensitization

Written by Grant D. Nicol and Michael R. Vasko

Pain Life Science Poster

Our Peripheral Sensitization poster gives a summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request copy or view PDF today.

divider line

New Products in this Area

BeKm 1

Potent and selective KV11.1 (hERG) channel blocker

Sign-up for new product e-alerts
divider line

Bio-Techne Events

Pharmacology 2016

Pharmacology 2016

December 13 - 15, 2016

London, UK

Booth: 7