CRSP-1

Cat. No. 3555

CRSP-1 Ser-Cys-Asn-Thr-Ala-Thr-Cys-Met-Thr-His-Arg-Leu-Val-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Ser-Met-Val-Arg-Ser-Asn-Leu-Leu-Pro-Thr-Lys-Met-Gly-Phe-Lys-Val-Phe-Gly-NH2

Price and Availability

For CRSP-1 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: Calcitonin receptor-stimulating peptide-1

Biological Activity

Endogenous central calcitonin (CT) receptor agonist that stimulates cAMP formation at a potency 350-fold greater than CT (ED50 values are 0.2 and 71 nM respectively). Displays no activity at calcitonin-gene related peptide (CGRP) and adrenomedullin receptors. Inhibits formation of multinuclear osteoclasts with similar efficacy to CT in vitro. Suppresses food intake and increases body temperature in free-feeding rats, and significantly decreases plasma calcium levels in vivo.

Technical Data

M.Wt:
4098.88
Formula:
C175H294N54O49S5
Sequence:
SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG

(Modifications: Disulfide bridge between 2 - 7, Gly-38 = C-terminal amide)

Solubility:
Soluble to 0.50 mg/ml in 10% acetonitrile / water
Storage:
Store at -20°C
CAS No:
697327-12-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

Notoya et al (2007) A novel member of the calcitonin gene-related peptide family, calcitonin receptor-stimulating peptide, inhibits the formation and activity of osteoclasts. Eur.J.Pharmacol. 560 234. PMID: 17328890.

Sawada et al (2006) Central effects of calcitonin receptor-stimulating peptide-1 on energy homeostasis in rats. Endocrinology 147 2043. PMID: 16410305.

Katafuchi et al (2003) Calcitonin receptor-stimulating peptide, a new member of the calcitonin gene-related peptide family. Its isolation from porcine brain, structure, tissue distribution, and biological activity. J.Biol.Chem. 278 12046. PMID: 12556539.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses CRSP-1 from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: CRSP-1, supplier, Endogenous, central, CT, receptors, calcitonin, agonists, Calcitonin, receptor, stimulating, peptide1, Tocris Bioscience, Calcitonin and Related Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

New Products in this Area

ML 233

Non-peptide apelin receptor agonist

BML 111

FPR2 (lipoxin A4 receptor) agonist

Amylin (rat)

Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors

Calcitonin (human)

Endogenous calcitonin receptor agonist; inhibits bone resorption

Spexin

Potent GAL2/3 agonist; exhibits anxiolytic effects in vivo

MM 54

Potent apelin receptor antagonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.