Parstatin (human)

Cat. No. 3553

Parstatin (human) Met-Gly-Pro-Arg-Arg-Leu-Leu-Leu-Val-Ala-Ala-Cys-Phe-Ser-Leu-Cys-Gly-Pro-Leu-Leu-Ser-Ala-Arg-Thr-Arg-Ala-Arg-Arg-Pro-Glu-Ser-Lys-Ala-Thr-Asn-Ala-Thr-Leu-Asp-Pro-Arg

Price and Availability

For Parstatin (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo.

Technical Data

M.Wt:
4467.29
Formula:
C191H330N64O53S3
Sequence:
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR
Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
1065755-99-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Strande et al (2009) Parstatin: a cryptic peptide involved in cardioprotection after ischaemic and reperfusion injury. Cardiovasc.Res. 83 325. PMID: 19380418.

Zania et al (2009) Parstatin, the cleaved peptide on proteinase-activated receptor 1 activation, is a potent inhibitor of activation. J.Pharmacol.Exp.Ther. 328 378. PMID: 18988770.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Parstatin (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Parstatin (human), supplier, Peptide, cleaved, PAR1, receptors, activation, Protease-Activated, proteinase-activated, Tocris Bioscience, Protease-Activated Receptor products

Quick Order

Find multiple products by catalog number

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

Cardiovascular Life Science Poster

Our Cardiovascular poster highlights the key G protein-coupled receptors involved in the regulation of vascular reactivity. Request copy today.

divider line

New Products in this Area

Calcitonin (human)

Endogenous calcitonin receptor agonist; inhibits bone resorption

Spexin

Potent GAL2/3 agonist; exhibits anxiolytic effects in vivo

MM 54

Potent apelin receptor antagonist

MSG 606

Potent human MC1 receptor antagonist; also MC3 and MC5 partial agonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

One Day Symposium

Bio-Techne Symposium 2017

Epigenetic Regulation of Stem Cell Differentiation

March 1, 2017

Amsterdam, The Netherlands