Brain natriuretic peptide (1-32) (human)

Cat. No. 3522

Brain natriuretic peptide (1-32) (human) Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His

Price and Availability

For Brain natriuretic peptide (1-32) (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous peptide secreted from cardiac ventricles in response to volume increase and pressure overload that acts as an agonist at atrial natriuretic peptide (ANP) receptor A (NRP1). Decreases de novo collagen synthesis and increases MMP gene expression in vitro. Exhibits natriuretic, vasodilatory and lusitropic activity and inhibits the sympathetic and renin-angiotensin-aldosterone systems in vivo.

Technical Data

M.Wt:
3464.05
Formula:
C143H244N50O42S4
Sequence:
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

(Modifications: Disulfide bridge between 10 - 26)

Solubility:
Soluble to 0.10 mg/ml in water
Storage:
Store at -20°C
CAS No:
124584-08-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

References are publications that support the products' biological activity.

Heublein et al (2007) Immunoreactivity and guanosine 3',5'-cyclic monophosphate activating actions of various forms of human B-type natriuretic peptide. Hypertension 49 1114. PMID: 17372040.

Wellard et al (2006) Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3',5'-cyclic monophosphate in ependymal cells ex vivo. Neurosci.Lett. 392 187. PMID: 16278044.

Tsuruda et al (2002) Brain natriuretic peptide is produced in cardiac fibroblasts and induces matrix metalloproteinases. Circ.Res. 91 1127. PMID: 12480813.

If you know of a relevant reference for Brain natriuretic peptide (1-32) (human) please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Brain natriuretic peptide (1-32) (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Brain natriuretic peptide (1-32) (human), supplier, Endogenous, peptide, agonists, ANP, receptor, A, NRP1, Receptors, Atrial, Natriuretic, Peptide, Tocris Bioscience, Natriuretic Peptide Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

New Products in this Area

TH 1020

Toll-like receptor (TLR) 5/Flagellin complex antagonist

Bioymifi

DR5 (TRAIL receptor) agonist; induces apoptosis

BOP

Dual α9β/1α4β1 integrin inhibitor; preferentially mobilizes HSCs

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.