ACTH (1-39)

Cat. No. 3492

ACTH (1-39) Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe

Price and Availability

For ACTH (1-39) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: Adrenocorticotropic hormone (1-39)

Biological Activity

Potent endogenous melanocortin receptor 2 (MC2) agonist (EC50 = 57 pM). Component of the hypothalamic-pituitary-adrenal (HPA) axis that stimulates glucocorticoid production and release from the adrenal cortex. Induces insulin resistance, promotes a proinflammatory profile and stimulates UCP-1 in adipocytes in vitro.

Technical Data

M.Wt:
4541.1
Formula:
C207H308N56O58S
Sequence:
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
12279-41-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Certificate of Analysis / Product Datasheet
Select another batch:

Bertolini et al (2009) Brain effects of melanocortins. Pharmacol.Res. 59 13. PMID: 18996199.

Iwen et al (2008) Melanocortin crosstalk with adipose functions: ACTH directly induces insulin resistance, promotes a pro-inflammatory adipokine profile and stimulates UCP-1 in adipocytes. J.Endocrinol. 196 465. PMID: 18310442.

Kapas et al (1996) Agonist and receptor binding properties of adrenocorticotropin peptides using the cloned mouse adrenocorticotropin receptor expressed in a stably transfected HeLa cell line. Endocrinology 137 3291. PMID: 8754753.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses ACTH (1-39) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: ACTH (1-39), supplier, Potent, endogenous, MC2R, agonists, Receptors, Melanocortin, acethropan, Tocris Bioscience, Melanocortin (MC) Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

New Products in this Area

Spexin

Potent GAL2/3 agonist; exhibits anxiolytic effects in vivo

MM 54

Potent apelin receptor antagonist

MSG 606

Potent human MC1 receptor antagonist; also MC3 and MC5 partial agonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

Pharmacology 2016

Pharmacology 2016

December 13 - 15, 2016

London, UK

Booth: 7