Insulin (human) recombinant
expressed in yeast

Cat. No. 3435

Insulin (human) recombinant, expressed in yeast Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn   Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr* (Disulfide bridge = 6 - 11, 7 -7*, 20 - 19*)

Price and Availability

For Insulin (human) recombinant
expressed in yeast
pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous insulin receptor agonist (Ki = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.

Technical Data

M.Wt:
5807.57
Formula:
C257H383N65O77S6
Sequence:
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT*

(Modifications: Disulfide bridge between 6 - 11, 7 -7*, 20 - 19*)

Solubility:
Soluble to 20 mg/ml in 0.01 M hydrochloric acid
Storage:
Store at -20°C
CAS No:
11061-68-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Certificate of Analysis / Product Datasheet
Select another batch:

Leney and Tavare (2009) The molecular basis of insulin-stimulated glucose uptake: signalling, trafficking and potential drug targets. J.Endocrinol. 203 1. PMID: 19389739.

Ou et al (2001) The binding characteristics of insulin-MTX to insulin receptor. Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao. 32 538. PMID: 12528542.

Torlinska et al (2000) Age dependent changes of insulin receptors in rat tissues. J.Physiol.Pharmacol. 51 871. PMID: 11220495.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Insulin (human) recombinant
expressed in yeast include:

Stretton et al (2015) GSK3-mediated raptor phosphorylation supports amino-acid-dependent mTORC1-directed signalling. Br J Pharmacol 470 207. PMID: 26348909.

Do you know of a great paper that uses Insulin (human) recombinant
expressed in yeast from Tocris? If so please let us know.

View Related Products by Product Action

Keywords: Insulin (human) recombinant, expressed in yeast, supplier, Endogenous, peptide, agonists, IGF, Receptors, nsulin-like, Receptor, Tyrosine, Kinases, RTKs, Tocris Bioscience, Insulin and Insulin-like Receptors Activator products

Quick Order

Find multiple products by catalog number

divider line

Kinase Inhibitor Toolbox

80 Kinase inhibitors
pre-dissolved in DMSO

Kinase Inhibitor Toolbox

Includes many of the latest kinase inhibitors to become commercially available. Covers a wide range of kinase targets including EGFR, MAPK and CDK.

divider line

Kinases Product Listing

Kinases Product Listing

Our Kinase listing highlights over 400 products for kinase research. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

Angiogenesis in Cancer

Taken from the Cancer Guide Edition 3

Angiogenesis in Cancer Poster

Our Angiogenesis in Cancer poster summarizes the pathogenesis of angiogenesis in cancer, as well as some of the main angiogenesis therapeutic targets. Request copy or view PDF today.

divider line

Insulin Pathway

Insulin Signaling Pathway

Signals through the insulin pathway are fundamental for the regulation of intracellular glucose levels. View pathway or download PDF today.

divider line

New Products in this Area

PF 06273340

Potent and selective pan-Trk inhibitor; peripherally restricted

HIOC

Selective TrkB receptor agonist; neuroprotectant

AV 412

Potent inhibitor of EGFR, ErbB2 and Abl receptor tyrosine kinases

CP 724714

Potent and selective ErbB2 inhibitor

Sign-up for new product e-alerts
divider line

Bio-Techne Events

AACR 2017

AACR Annual Meeting 2017

April 1 - 5, 2017

Washington, D.C., USA

Booth: 1239