Insulin (human) recombinant
expressed in yeast

Cat. No. 3435

Insulin (human) recombinant, expressed in yeast Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn   Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr* (Disulfide bridge = 6 - 11, 7 -7*, 20 - 19*)

Price and Availability

For Insulin (human) recombinant
expressed in yeast
pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous insulin receptor agonist (Ki = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.

Technical Data

M.Wt:
5807.57
Formula:
C257H383N65O77S6
Sequence:
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT*

(Modifications: Disulfide bridge between 6 - 11, 7 -7*, 20 - 19*)

Solubility:
Soluble to 20 mg/ml in 0.01 M hydrochloric acid
Storage:
Store at -20°C
CAS No:
11061-68-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Leney and Tavare (2009) The molecular basis of insulin-stimulated glucose uptake: signalling, trafficking and potential drug targets. J.Endocrinol. 203 1. PMID: 19389739.

Ou et al (2001) The binding characteristics of insulin-MTX to insulin receptor. Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao. 32 538. PMID: 12528542.

Torlinska et al (2000) Age dependent changes of insulin receptors in rat tissues. J.Physiol.Pharmacol. 51 871. PMID: 11220495.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Insulin (human) recombinant
expressed in yeast from Tocris? If so please let us know.

View Related Products by Product Action

Keywords: Insulin (human) recombinant, expressed in yeast, supplier, Endogenous, peptide, agonists, IGF, Receptors, nsulin-like, Receptor, Tyrosine, Kinases, RTKs, Tocris Bioscience, Insulin and Insulin-like Receptors Activator products

Quick Order

Find multiple products by catalog number

divider line

Kinase Inhibitor Toolbox

80 Kinase inhibitors
pre-dissolved in DMSO

Kinase Inhibitor Toolbox

Includes many of the latest kinase inhibitors to become commercially available. Covers a wide range of kinase targets including EGFR, MAPK and CDK.

divider line

Kinases Product Listing

Kinases Product Listing

Our Kinase listing highlights over 400 products for kinase research. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

VEGF Pathway & Anti-Angiogenic Therapy

Written by N. Ferrara & Y. Crawford

Angiogenesis Life Science Poster

A summary of antiangiogenic therapies targeting the VEGF pathway and the mechanisms of therapy resistance. Request copy today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

Insulin Pathway

Insulin Signaling Pathway

Signals through the insulin pathway are fundamental for the regulation of intracellular glucose levels. View pathway or download PDF today.

divider line

New Products in this Area

HIOC

Selective TrkB receptor agonist; neuroprotectant

AV 412

Potent inhibitor of EGFR, ErbB2 and Abl receptor tyrosine kinases

CP 724714

Potent and selective ErbB2 inhibitor

Mitoglitazone

Insulin sensitizer; exhibits low binding affinity at PPARγ

PF 6274484

High affinity and potent covalent EGFR kinase inhibitor

Canertinib dihydrochloride

Potent EGFR kinase inhibitor

CHMFL-FLT3-122

Potent and selective FLT3 inhibitor

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.