Amyloid β-peptide (42-1) (human)

Cat. No. 3391

Amyloid b-peptide (42-1) (human) Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp

Price and Availability

For Amyloid β-peptide (42-1) (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Inactive control peptide for amyloid β-peptide (1-42) (Cat. No. 1428), the predominant form of amyloid β-peptide found in the brains of patients with Alzheimer's disease.

Technical Data

M.Wt:
4514.08
Formula:
C203H311N55O60S
Sequence:
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Solubility:
Soluble to 0.50 mg/ml in water
Storage:
Store at -20°C
CAS No:
317366-82-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Xiong et al (2007) Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina. Exp.Brain Res. 181 435. PMID: 17429617.

Boyd-Kimball et al (2005) Proteomic identification of proteins oxidized by Aβ(1-42) in synaptosomes: Implications for Alzheimer's disease. Brain Res. 1004 206. PMID: 15885219.

Walsh et al (2002) Amyloid-beta peotide is toxic to neurons in vivo via indirect mechanisms. Neurobiol.Dis. 10 20. PMID: 12079400.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Amyloid β-peptide (42-1) (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Amyloid b-peptide (42-1) (human), supplier, Inactive, control, peptide, β-Amyloid, beta-Amyloid, b-amyoid, Precursor, Protein, APP, Secretase, beta, Peptides, Amyloid, β-peptide, beta-peptide, (42-1), (human), amyloidbeta, amyloidb, amyloidβ, Tocris Bioscience, Amyloid β Peptide products

Quick Order

Find multiple products by catalog number

divider line

Neurodegeneration Research Product Guide

Neurodegeneration Product Guide

Our Neurodegeneration guide highlights over 275 products for neurodegeneration research. Request copy or view PDF today.

divider line

Alzheimer's Disease: Neurobiology and Drug Targets

Written by Alan Palmer

Alzheimer's Life Science Poster

Our Alzheimer's disease poster summarizes the structural and functional changes observed in the progression of this neurodegenerative disease. Request copy or view PDF today.

divider line

New Products in this Area

BAM 15

Mitochondrial protonophore uncoupler

RS 1

High affinity RAD51 activator; also CRISPR enhancer

6-Hydroxy-DL-DOPA

Allosteric inhibitor of RAD52; also APE1 inhibitor

Sign-up for new product e-alerts
divider line

Bio-Techne Events

Neuroscience 2016

Neuroscience 2016

November 12 - 16, 2016

San Diego, CA, USA

Booth: 3217