Thymosin β4

Cat. No. 3390

Thymosin b4 Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-
Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser

Price and Availability

For Thymosin β4 pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Naturally occuring, potent regulator of actin polymerization present in human platelets at a concentration of 200 - 500 μM. Sequesters G-actin monomers in a 1:1 ratio (Kd = 0.7 - 1.0 μM) and allows rapid filament polymerization in the presence of profilin. Implicated in wound healing, induction of MMPs, chemotaxis, angiogenesis, inflammatory processes and tumor progression.

Technical Data

M.Wt:
4963.49
Formula:
C212H350N56O78S
Sequence:
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

(Modifications: Ser-1 = N-terminal Ac)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
77591-33-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Certificate of Analysis / Product Datasheet
Select another batch:

Smart et al (2007) Thymosin β4 and angiogenesis: modes of action and therapeutic potential. Angiogenesis 10 229. PMID: 17632766.

Huff et al (2001) β-thymosins, small acidic peptides with multiple functions. Int.J.Biochem.Cell Biol. 33 205. PMID: 11311852.

Yu et al (1993) Thymosin β10 and thymosin β4 are both actin monomer sequestering proteins. J.Biol.Chem. 268 502. PMID: 8416954.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Thymosin β4 from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Thymosin b4, supplier, Potent, actin, polymerization, regulator, Thymosin, β4, beta4, Thymosinβ4, Thymosinb4, polymerisation, Tocris Bioscience, Actin products

Quick Order

Find multiple products by catalog number

divider line

Cancer Research Product Guide

Cancer Research Product Guide

Our Cancer Research Guide highlights over 750 products for cancer research. Request copy or view PDF today.

divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.