CART (55-102) (human)

Cat. No. 3338

CART (55-102) (human) Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu

Price and Availability

For CART (55-102) (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Cocaine- and amphetamine-regulated transcript (CART) with potent appetite-suppressing activity. Satiety factor; inhibits normal and starvation-induced feeding. Closely related to the actions of leptin and neuropeptide Y; blocks the neuropeptide Y-induced feeding response.

Technical Data

M.Wt:
5245.18
Formula:
C225H365N65O65S7
Sequence:
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

(Modifications: Disulfide bridge between 14 - 32, 20 - 40, 34 - 47)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
214050-22-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

References are publications that support the products' biological activity.

Ludvigsen et al (2001) Solution structure of the satiety factor, CART, reveals new functionality of a well-known fold. Biochemistry 40 9082. PMID: 11478874.

Thim et al (1998) CART, a new anorectic peptide. Int.J.Biochem.Cell Biol. 30 1281. PMID: 9924797.

If you know of a relevant reference for CART (55-102) (human) please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses CART (55-102) (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: CART (55-102) (human), supplier, CART, human, peptide, fragment, 55-102, neuromodulator, satiety, factor, inhibits, feeding, Tocris Bioscience, Other Peptide Receptor products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

New Products in this Area

Retrobradykinin

Reverse analog of Bradykinin

TASP 0390325

Potent and selective V1B receptor antagonist; orally bioavailable

ML 233

Non-peptide apelin receptor agonist

BML 111

FPR2 (lipoxin A4 receptor) agonist

Amylin (rat)

Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors

Calcitonin (human)

Endogenous calcitonin receptor agonist; inhibits bone resorption

Spexin

Potent GAL2/3 agonist; exhibits anxiolytic effects in vivo

MM 54

Potent apelin receptor antagonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.